KEGG   Ralstonia pickettii 12J: Rpic_3334Help
Entry
Rpic_3334         CDS       T00762                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rpic_3334
Enzymes [BR:rpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rpic_3334
Exosome [BR:rpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpic_3334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3489086..3490582
Genome map
AA seq 498 aa AA seqDB search
MEYLLALDQGTSSSRAIVFNRAGQIVASAQQEFPQHFPQPGWVEHDPFDIWNSQLATCRA
ALEQAKLSAADMAALGITNQRETTMVWERATGKPIFNAIVWQDRRTEAICESLRAEGLED
EVRKRTGLIIDPYFSATKLRWILDHVDGGRERAARGELAFGTIDSWLVWQLTRGRLHVTD
VSNASRTMLWNIHTGEWDADLMRALDIHPSLLPEVHPSAHQFGQTDADWLGASLTIGGIA
GDQQSALFGQACFKPGMAKNTYGTGCFMLLNTGDKAVQSHNGLISTAACQSGTKRSYALE
GSVFVGGAVVQWLRDGLRAIQRSADVEGLAASVPDSGGVVFVPSFTGLGAPYWDPTAQGA
IVGLSRGTTIGHIARAALESIAFQSTALLQAMTRDAVSTISELRVDGGASANNLLLQFQA
DLLGIPVVRPEIIETTALGAAYLAGIATGFYRDEAEVAQQWRASRTFHPVISRDEAAHRI
AQWEMAVAQVRLPTTRGH
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaatacctcctcgcgctcgaccagggcacatccagctcacgcgccatcgtcttcaac
cgcgccggccagatcgtcgccagtgcccagcaggagtttccgcagcatttcccgcagccc
ggctgggtcgagcatgacccgttcgacatctggaacagccagctcgccacctgccgcgcc
gcactcgaacaagccaagctctccgctgccgacatggcggcgcttggcatcaccaaccag
cgcgaaaccaccatggtgtgggagcgcgccacgggcaaaccgatcttcaacgccatcgtc
tggcaggaccgccgcaccgaagccatctgcgaaagcctgcgcgccgagggcctggaagac
gaggtgcgcaagcgcaccggcctgatcatcgatccgtatttttcggccaccaagctgcgc
tggattctcgaccacgtggacggcggccgcgagcgcgcggcacgtggcgaacttgccttc
ggcaccatcgacagctggctcgtctggcaactcacacgcggccgcctgcatgtgaccgac
gtatcgaacgcttcccgcacgatgctgtggaacatccacaccggcgaatgggatgcggac
ctgatgcgcgcgctcgacattcacccgagcctgttgcccgaggtgcatccgtctgcgcat
cagttcgggcagaccgatgccgactggctcggcgcctcgctcaccatcggcggcattgcc
ggcgaccagcaatcggcgctcttcggccaggcctgcttcaagccgggcatggccaagaac
acctacggcaccggctgtttcatgttgctcaacacgggcgacaaagcggtccagtcgcac
aacggcctcatcagcacggcggcatgccagagcggcacgaagcgcagctatgcgctcgaa
ggcagcgtattcgtcggtggcgcggtggtgcagtggctgcgcgacggcctgcgcgccatc
cagcgctccgccgacgtcgaaggcctggccgcctcggtgcccgattccggcggcgtggtg
ttcgtgccgtcgttcacgggcctgggggcaccgtactgggaccccaccgcgcagggcgcc
atcgtcggcctctcgcgcggcacaaccatcggccacatcgcacgtgcggcgctcgaatcc
atcgccttccagagcaccgcattgctgcaggctatgacgcgcgatgccgtttccaccatc
tcggaactgcgcgtcgatggcggcgcctcggccaacaacctgctcctgcagttccaggct
gacctgctcggcattccggtcgtgcgtccggagatcatcgagaccacggcgctgggggcg
gcttacctggcgggcatcgccaccggcttctatcgtgatgaagccgaggtcgcccagcaa
tggcgtgcctcgcgcacgttccaccccgtcatcagccgcgacgaggccgcacaccgcatc
gcccaatgggaaatggccgttgcgcaggtccgcctgccgacaacgcgcggccactga

DBGET integrated database retrieval system