KEGG   Ralstonia pickettii 12J: Rpic_3374Help
Entry
Rpic_3374         CDS       T00762                                 

Definition
molybdopterin-binding aldehyde oxidase and xanthine dehydrogenase
Orthology
K11177  
xanthine dehydrogenase YagR molybdenum-binding subunit [EC:1.17.1.4]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rpi00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3534926..3537124)
Genome map
AA seq 732 aa AA seqDB search
MSNVGQPLDRTDGLLKVTGQARYSAEFQVPRLVHAVLVQSTVPAGRITRVDTHVAQAMPG
VLLVMTHENAPRLPNDGKPALEPPAGRVLSLLQDDQVHYNGQPVAVVVGDTLEHAQAAAR
MVRVEVAQQPARLDFETARADAHSPGKVQTQSADTMRGDMASGMAQAAQRIEAIYGTPME
AHNPMEPHATIAVWEGDSLTLYDSTQYVSGVRRTVAKTLGLSPDKLRVVCPFVGGGFGCK
GSVWSHVVLAAMAARQAGRPVKLVLERAQMFGPVGGRPRTEQRIAMGAASDGRFTAISHD
SLTTTSMIEDWTEPCAIVTRMLYDTPNQRTTHRLARLNVGTPTFQRAPGEATGTFALEVA
LDEMAYALGIDPVELRLRNDAAQDPEKRIPWSSKSLAACYRTGAERFGWARRNPQPGSMR
EGTTRVGWGMATATYPANRSAAAATARYLPDGTAQVESGSQDLGTGTYTVMTQVAADAMG
MPVDRVLFSLGDTRMPEAPVSGGSQSVASVSPAVQAAGQQARDALIAAAIADASSPLHGL
DAGAITVADGVLSAHSGAREPAAAVVARYGRPIEVTAKVQPGEEKQKFSMHSFGAVFAEV
HVDADLGVIRVSRIVGSYGVGRLLNAKTGRSQLMGGIVWGIGMALFEESLLDPRYGRIVN
NNLAEYHVPVNADVPDIDILVLDEADPHINPLGAKGIGEIGITGVPAAIANAVYHATGRR
VRELPITLDKLI
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgtcggccaaccgctggaccgcactgacggtctgcttaaagtcacgggccag
gcacgctactcggccgagtttcaggtgccgcgtctggtgcatgcggtgctggtgcaaagc
acggtgcccgccggccgaatcacccgggtggatacacacgttgcgcaggccatgcccggc
gtgctgctggtgatgacgcacgagaacgcgccgcgcttgcctaacgatggcaagcccgcg
ctggaaccgccggccggacgcgtgctctcgttgctgcaggacgatcaggtgcactacaac
ggccagcccgtggcggtcgtcgtgggcgacactctggaacacgcgcaggccgcagcgcgc
atggtgcgcgtagaggttgcccagcagccggcgcggctcgacttcgaaaccgcccgcgcc
gatgcgcactcgcccggcaaggtgcagacgcaatcggccgataccatgcgcggcgatatg
gcctccggcatggcgcaggcggcgcagcgcatcgaggccatctacgggacgcccatggaa
gcgcacaacccgatggagccgcacgccaccatcgccgtgtgggagggcgattcgctcacg
ttgtacgacagcacgcagtacgtctcgggtgtgcgccgcaccgtcgccaagacgctaggt
ctgtcgcctgacaagctgcgtgtggtgtgcccgttcgtgggcggcgggttcggctgcaaa
ggctcggtgtggtcgcacgtggtgctggcggcgatggccgcgcgccaagcggggcggccc
gtcaagcttgttctggagcgggcgcagatgttcggccccgtcggcgggcgcccgcgtacc
gagcagcgcatcgccatgggcgccgccagcgatggccgcttcaccgccatctctcacgac
tcgctgaccaccacgtcgatgattgaggattggaccgagccctgcgccatcgtcacgcgc
atgctttacgacacgcccaaccagcggacgacgcatcggctggcgcgtttgaacgtcggt
acgcccaccttccagcgcgcacccggcgaagccactggcacgttcgcgctggaagtcgcg
ctggatgagatggcctacgcgcttggcatcgaccccgtggaactgcgcctgcgcaacgat
gccgcccaagacccggaaaaacgcatcccgtggtcgagcaaatccctggctgcctgctac
cggacgggcgccgagcgcttcggctgggcgcgccgcaacccgcagccgggcagcatgcgc
gagggcactacgcgcgtcggctggggcatggccacggccacgtacccagccaatcgcagc
gcggctgctgccacggcgcgctatctgcccgacggtacggcgcaggtcgaatcgggatcg
caggatctgggcaccggcacttacacggtgatgacgcaggtggcggccgatgccatgggc
atgcccgtcgaccgcgtgctcttcagtctgggcgatacgcgcatgcccgaagcgccggtg
tcgggcggctcgcagagcgtggccagcgtatcgcccgcggtgcaggccgccggccagcag
gcacgcgatgcattgattgccgcggccattgccgacgccagttcgccgctgcatgggctg
gacgcgggcgccatcacggtggccgatggtgttctgagcgcacacagcggtgctcgggaa
ccggcggctgccgtagtcgcccgctatggtcgccccatcgaggtgaccgccaaggtgcag
ccgggcgaagagaagcagaagttctcaatgcactcgttcggcgcggtgtttgccgaggtc
catgtcgacgcggacctgggcgtgatccgcgtctcgcgcatagtggggagctacggcgtc
gggcggttgctcaacgccaagacgggccgtagccagctcatgggcggcatcgtctggggc
ataggcatggcgctgttcgaagagagcctgctggacccgcgttacggtcgcatcgtcaac
aacaacctggcggagtaccacgtgcccgtcaacgccgatgtgcccgacatcgacatcctc
gtactcgacgaggcggacccgcacatcaacccgctgggcgccaagggcatcggcgagatc
ggcatcaccggcgtgccggcggccatcgccaacgccgtctatcacgccaccggccggcgc
gtgcgcgaattgccgatcacgctcgacaagctcatctga

DBGET integrated database retrieval system