KEGG   Ralstonia pickettii 12J: Rpic_3786Help
Entry
Rpic_3786         CDS       T00762                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rpic_3786
   00052 Galactose metabolism
    Rpic_3786
   00500 Starch and sucrose metabolism
    Rpic_3786
   00520 Amino sugar and nucleotide sugar metabolism
    Rpic_3786
Enzymes [BR:rpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rpic_3786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:28088..29041
Genome map
AA seq 317 aa AA seqDB search
MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFITGR
AKRAIEDHFDKAYELETELAAKNKQALLDMVQSIKPAGVECFYVRQPETLGLGHAVLCAQ
KLVRDEPFAVILADDLLDHEPPVMQQMTELYDHYRCSIVGVETIAPEATRSYGVVAGREW
DDRLVKLDGIVEKPAPSEAPSNLGVVGRYILTPRIFDHLRNLRPGAGGELQLTDAIQSLL
AEEQILAYRYRGQRFDCGSKFGYLQATVEFALRHPEVRADFETYLNERLGRAPDQATPLG
KSDRRLREDTIALSVAA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaagatcaccaaggccgtgtttcccgtggcggggctcggtacgcgtttccta
cccgccaccaaggccagccccaaagagatgttgccgatcgtcgacaagccgctcatccaa
tatgcggtggaagaggcggccgcggcgggcatcacggagatgatcttcatcaccgggcgc
gccaagcgcgcaatcgaagaccactttgacaaggcgtacgaactcgaaaccgaactggcg
gccaagaacaagcaggcgttgctggacatggtgcagtcaatcaagccggccggcgtcgag
tgtttctatgtgcgccagcccgagacgctggggcttggccacgcggtgttgtgcgcgcag
aaattggtacgcgacgagccctttgccgtgattctggcggacgatctgctcgatcacgag
ccccccgtcatgcagcagatgaccgagctgtacgaccactaccgctgctccattgtcggt
gtcgagacgatcgcgccggaggcgacgcgttcatacggcgtcgtggcggggcgggaatgg
gatgaccggctggtcaagctcgatggcatcgtggagaagccggcgccaagcgaggcgccg
tccaatctgggcgtggttgggcgctatatcctgacgccgcgtatcttcgatcatctgcgc
aacctgaggccgggtgccggcggcgaactgcaattgaccgatgcgatccagagccttctg
gccgaagaacagatcctggcgtatcgctaccgcggtcagcgattcgactgcggcagcaag
tttggctacctgcaggcgacggtcgagtttgcgcttcgccatccggaagtgcgcgctgac
ttcgaaacgtatctgaacgaacgccttggtcgggcgcccgaccaggcgacacccttgggc
aagtcggaccggcggttgcgcgaagacaccattgcgctgagtgtggcggcctga

DBGET integrated database retrieval system