KEGG   Ralstonia pickettii 12J: Rpic_3934Help
Entry
Rpic_3934         CDS       T00762                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rpi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(180846..183128)
Genome map
AA seq 760 aa AA seqDB search
MDRTTNLSGTPRTPLQQLATDAGLLVDWEDAASRPMRVADEVLRAVLFTLGLPAGTPAQV
SESQARLRAEAEAVAIPPLVTGVVGQPIVLQTSAPQAALLDGQPYRVDFESDGSTEGRIS
VSASEHHATLRLAAVQAVGYHRLTIDAGPGTVIEATLAIAPARCYGVADALRQHDRPTDS
RLWGASAQLYGLRCDAERAASSAGLGDYTAAGTLARHLSQRGADALALSPVHAMFTADPR
RYSPYSPSSRLFLNAWMIDPAALFGNETVRQAVVDCNLVADYARLEAAPLIDWPASGNAR
MTVLRALHRRLLQAPLGDTIGQTLLDDFRAYCINGGASLRDHAHFEALNAHLGPAHWKQW
PAQYQDPSYLGVQAFAREHEDAVNFHLFLQWAAARQWAIAQRTAEGAGMAIGLVADLAVG
TDSAGSHAWARQRDLLIGVTVGAPPDVFNAQGQGWGLTTFSPRAMRTQGFSAFIEMLRAV
MAVPGGVRIDHVLGLMRLWVIPDGARPLDGVYLRYPMQDLLRLVALESWRNRCIVIGEDL
GTVPAGLRDKLADDGLLGMRILWFEREYTRDDAPFKAPRTWAPASVAMTSTHDLPTLVGW
WIGNDLRWQAQLGLLPAGMSESEAHARRMDDRAALVAAFAEHNRLVLADGGVPMIGVASL
QAALEQTRVATAAQAEVILQASAQDFATAATVFTGAANTPLALVPLEDLLGLVEQPNLPS
TIDTHPNWRRRLPGPAGTLIEAPTVLARLSALANARNSMS
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcacgaccaacctatccggcacgccgcgcacgccgctccagcaactggccacc
gatgccgggctgctggtcgactgggaagatgctgccagccggcccatgcgcgtggccgac
gaggtgctgcgcgccgtgctcttcacgctcggcctgccggccggcaccccggcccaggtg
tcggaaagccaggcgcgcctgcgcgcggaagccgaagcggtggccataccgccgctcgtg
accggcgtggtcgggcaaccgatcgtgctgcagacgtctgcgccccaagccgcgttgctg
gacggacaaccctatcgtgttgatttcgagtccgacggcagcaccgagggcaggatcagc
gtcagcgcaagcgagcaccatgcaacgctgcgcctggcagcggtacaggccgttggctac
caccgcctgaccatcgacgccgggccgggcaccgtgatcgaagccacgctcgccattgct
cctgcgcgttgctatggtgtggccgatgcgctacgccagcacgatcgccccaccgactca
cgcctgtggggcgcctccgcacagctctatggcttgcgatgcgatgcggaacgcgcggcc
agcagcgcaggcctgggcgactacaccgccgcgggcacgctggcgcggcatctctcgcag
cgcggcgcggatgcgttggcactgagccctgtgcacgccatgttcacggccgacccgcgt
cggtattcgccgtactcgccatcgagccgcctgttcctgaacgcgtggatgatcgacccg
gccgcgctctttgggaacgaaaccgtacggcaagccgtggtcgactgcaacctcgtcgcg
gactatgcccggctggaagccgcaccgctcatcgactggccggccagcggcaacgcccgc
atgacggtgctgcgcgcgctgcatcggcgcctgctgcaagcaccgctcggagacaccatc
ggccagacgctgctggacgattttcgcgcgtactgcatcaatggcggcgccagcctgcgc
gaccatgcgcactttgaagcgctgaatgcgcaccttgggcccgcgcattggaagcagtgg
cccgcgcagtatcaagatccgagctacctgggcgttcaggccttcgcgcgtgagcatgaa
gatgcggtgaacttccacctcttcctgcaatgggcggcggcacgccagtgggccatcgcg
cagcgcaccgcggagggcgccggcatggccatcggcctcgtcgccgacctggctgttggc
accgacagcgcaggcagccacgcgtgggcccggcaacgcgacttgctgatcggcgtgacg
gtgggtgcgccgcccgatgtgttcaacgcacagggccagggctggggcctgaccaccttc
agcccgcgtgccatgcgcacgcaaggcttttcggcctttatcgagatgctgcgcgcggtg
atggccgtgcccggcggtgtgcgcatcgaccacgtgctcgggctcatgcggctgtgggtg
attcccgatggcgcgcggccgctcgacggcgtgtacctgcgctacccgatgcaggatctg
ctgcggctggtggcgctggaatcgtggcgcaaccgatgcatcgtcattggcgaagacctg
ggcaccgtgcctgctggcctgcgcgacaagctcgccgacgacggcctgctcggcatgcgc
atcctctggttcgagcgcgaatacacgcgcgacgatgcgcccttcaaggcgccgcgcacg
tgggcgccagcctccgtcgcgatgaccagcacgcacgacctgcccacgctcgtcggctgg
tggatcggcaacgatctgcgctggcaagcccagctcggcctgctgccggccggcatgagc
gagagcgaggcgcacgcgcgccgcatggacgatcgcgccgcactggttgccgcctttgca
gagcacaaccggctggtgctggccgatggcggcgtgccgatgatcggcgtggcgtcgctg
caggcggcgctggaacagacgcgcgtggccaccgcggcgcaagctgaagtcatcttgcaa
gccagcgcgcaggactttgccacggcagccaccgtgtttacgggcgcggccaatacgccg
cttgcgctggtgccgctggaggacttgctcggccttgtcgagcagcccaacctgccgagc
acgatcgacacacacccgaactggcgacgtcgtctgccagggccggccggcacgctgatc
gaggcacccacggtgctggcgcgcctgtcagcgctggccaacgcgcgcaacagcatgtca
tga

DBGET integrated database retrieval system