KEGG   Ralstonia pickettii 12J: Rpic_4054Help
Entry
Rpic_4054         CDS       T00762                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpic_4054
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rpic_4054
Enzymes [BR:rpi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rpic_4054
Two-component system [BR:rpi02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Rpic_4054
Bacterial motility proteins [BR:rpi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rpic_4054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:323356..324483
Genome map
AA seq 375 aa AA seqDB search
MNDKRKIQVLCIDDSALIRSILKEIINSQPDMEVVGVAPDPIIARDLIKQTNPDVLTLDV
EMPKMDGLDFLEKLMRLRPTPVVMISSLTERGSEATLRALELGAVDFVAKPKLGMRDGMN
EYADQIADKIRAAARAKLRPRTAAPVAAAGSATASTPGAHVRAEHAPATPALARTHFSST
EKLIIVGASTGGTEAIKDFLLEMPPDCPGILIVQHMPAGFTTSFAKRLDGLCRIRVKEAA
HGERVLPGHAYIAPGDMHLSLGRSGANYVTELDQGPPVNRHRPAVDVLFRSAARNAGANA
LGVILTGMGKDGAVGMLEMRNAGAYNVAQDEASCVVYGMPKEAVAHGGVHEVLPLSQIGP
HVLAKLSAHGRVTRV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaaacgcaagattcaggtgctgtgcatcgacgattccgcactgatccgcagc
atcctgaaggagatcatcaacagccagccggacatggaagtggtgggtgtggcgcccgat
ccgatcatcgcgcgcgacctcatcaagcagaccaatccggacgtgctcacgctggacgtc
gaaatgccgaagatggacggcctcgacttcctggaaaagctcatgcgcctgcgcccgacg
ccggtggtcatgatctcttcgctgacggagcgcggctctgaagccacactgcgcgcgctg
gagctgggcgcggtggattttgtcgccaagcccaagctgggcatgcgcgacggcatgaac
gaatacgccgaccagattgccgacaagatccgcgcggcagcacgggcaaagctgcgtccg
cgcacagccgcaccggttgctgcggccggctcggcaacggcatcgacgcccggcgcacac
gttcgcgcggagcacgcaccggccacgccggcacttgcgcgtacccatttctcgtcgacg
gaaaagctcatcatcgtgggcgcttccacaggcggcaccgaggccatcaaggatttcctg
ctggaaatgccgcccgactgccccggcatcctgatcgtgcagcacatgccggcgggtttc
accacgtcgtttgccaagcggctggacggcctgtgccgcatccgcgtgaaggaagccgcg
cacggcgagcgtgtgctgcccggccatgcctacattgccccgggtgacatgcacctgtcg
ctgggccgcagcggcgccaactacgtcacggagctggaccagggcccgccggtcaaccgc
catcgtccggccgtggatgtgctcttccggtccgccgcgcgcaacgccggtgccaacgcc
ctgggcgtcatcctcaccggcatgggcaaggacggcgcggtgggcatgctggaaatgcgc
aacgccggcgcctacaacgtcgcgcaggacgaggcgtcctgtgtggtctacggcatgccc
aaggaagccgtggcccacggcggcgtgcacgaagtcctgccgctgtcgcagatcggcccg
cacgtgctggccaagctgtctgcacatggccgcgtgacgcgggtttaa

DBGET integrated database retrieval system