KEGG   Ralstonia pickettii 12J: Rpic_4059Help
Entry
Rpic_4059         CDS       T00762                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rpic_4059
Enzymes [BR:rpi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Rpic_4059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:327484..329433
Genome map
AA seq 649 aa AA seqDB search
MMTKHQQSPSTQQEEALSVPGRRRFMNSAALAGLATVVACTDKGTPAAAPAASASAPTAT
AAGEHVIAGLHPKPGELDTYYGLWSGGHTGDMRVMGMPSGREIHRIPMFVPDALVGWGIT
NESKKVMGTKPDGSLRYTVGDTHHVHASYKDGNYDGRYAWINDKINSRLGRVRLDYFICD
KITELPNVQGFHGIFPDKRDPLDPKINYTTRVFCGGEFAIPLPNTAGIDDPSKYRSLFTC
VDAETMEVRWQVLIDGNCDLVATSYDGKLAATNQYNTEMGVHYEDMMSAERDACLFFNVA
RIEAAVKAGKFKTIGDSKVPVVDGTHAANQDPKTALTAYVSVPKNPHGVNASPDQKYFVC
AGKLSPTGTVIELSRVLDWFDGKLAKIDDAIVAEVELGLGPLHTAFDGRGNAYTTLFLDS
QIVKWNIDAAIKFHNGDKNAKYVVDRLDVHYQPGHLSASQSETMAADGKFLAVGCKFSKD
RFLPVGPLHPENEQFIDISGDKMVLLQDHPIRSEPHDFIIFKRELLHPKQVYSLDDFPLA
TKDPKQSGVVRNGKKVTVRLTSQAPAYSLREFKLKKGDEVTLILTNLDKVEDLTHGFAIP
KYNINFIVNPQETASVTFIADKPGVFWCYCTHFCHALHLEMRSRMIVEA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaagcaccaacaatcgccatccacacagcaggaagaagcgctgagcgtaccg
gggcggcgtcgcttcatgaatagcgcagcgcttgccgggttggcaacggtcgtggcatgc
actgacaagggcacacccgctgccgcacccgccgcatctgccagcgcgcccacggccacg
gccgcaggggaacacgtcatcgcgggcttgcatccgaagccgggtgaactcgacacctac
tacggcctgtggagcggcggacataccggtgacatgcgtgtcatgggcatgccctcgggg
cgcgagatccatcgcattccgatgttcgtgcccgatgcgctggtcggctggggcatcacg
aacgaatcgaagaaggtgatgggtacgaagcccgacggcagtctcaggtacacggtgggc
gatacccaccacgtgcacgcgtcgtacaaggatgggaattacgacggccgctatgcgtgg
atcaacgacaagatcaactcgcgcctggggcgcgtgcggctcgactacttcatctgcgac
aagatcaccgaactgccgaacgtgcagggcttccacggcatcttcccggacaagcgcgat
ccgctcgacccgaagatcaactacacgacgcgcgtgttctgcggcggcgagtttgcgatc
ccgctaccgaacacggcgggcatcgatgatccgtccaagtaccgttcactgttcacgtgc
gtggacgctgaaaccatggaagtgcgctggcaggtgctgatcgacggcaattgcgacctc
gtcgcaacgtcgtacgacggcaagctggccgcgaccaaccagtacaacaccgagatgggc
gtgcactacgaagacatgatgtctgcggagcgcgatgcctgtctgttcttcaacgttgcg
cgcatcgaggcggcggtcaaggccggcaagttcaagaccatcggcgactccaaggtgccg
gtggtggacggcacgcacgcggccaaccaggatccgaagacagcactgaccgcttatgtg
tcggtgccgaagaatccgcacggcgtcaatgccagccccgaccagaagtacttcgtctgt
gccggcaagctttcgcccaccggtacggtcatcgagctgtctcgcgtgctcgactggttc
gacggcaagctcgccaagatcgacgacgccatcgtggcggaggtcgaacttggcctgggg
ccgctgcacactgcgttcgacgggcgcggcaacgcatacacgacgctgttcctcgacagc
cagatcgtgaagtggaacattgacgccgccatcaagttccacaacggtgacaagaacgcg
aagtacgtggtcgaccgccttgacgtgcattaccagccgggccacctgagcgcatcgcaa
tccgaaaccatggccgccgacggcaagttcctcgccgtgggctgcaagttctccaaggac
cgcttcctgcccgttggcccgctgcaccccgaaaacgaacagttcatcgacatctccggc
gacaagatggtgctgctgcaggaccacccgatccgcagcgagccgcacgacttcatcatc
ttcaagcgcgagctgctgcacccgaagcaggtctattcgctggacgatttcccgctggcc
accaaggacccgaagcagtccggcgtggtgcgcaatggcaagaaggtgacggtgcggctc
acctcgcaggcaccggcgtacagcctgcgcgagttcaagctgaagaagggcgacgaggtc
acgctgatcctcaccaatctggacaaggtcgaggatctgacgcacggcttcgcgattccg
aaatacaacatcaacttcatcgtcaatccgcaggaaaccgcgtcggtcacgttcattgcc
gataagcccggcgtgttctggtgctactgcacgcatttctgtcatgcactgcaccttgaa
atgcgcagtcgcatgatcgttgaggcctga

DBGET integrated database retrieval system