KEGG   Ralstonia pickettii 12J: Rpic_4206Help
Entry
Rpic_4206         CDS       T00762                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rpi  Ralstonia pickettii 12J
Brite
Enzymes [BR:rpi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Rpic_4206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:487861..489252
Genome map
AA seq 463 aa AA seqDB search
MSRVLPAATFRVIAVSALAGVVVVLCGCGRGDPAAHAATVAASAPAAVAPSTAAGVKPAA
APAYEKAFYTMMATRRPSVPAMAALGKALFFDPALSASGKQACASCHSPTHAYGPPNDLS
VQLGGTGMNKTGVRAAPSLRYLQKVPPFSEHFYESDGNDSEDQGPTGGYTWDGRVSSTHD
QARIPLLSGHEMANGTQASVVAKLRNGRHAQTFRQVFGNDILDNEDTAFRAALMVLEVFQ
ETPSEFYPYDSKYDAFLRKQVKLSPQELRGLKAFADPAKGNCASCHVSAIKQDGAFPAFT
DFGHIAVGVPRNRSLAANADPKFFDLGLCGPDRTDLKDRTDYCGRFRTPSLRNVALRKTF
FHNGAIHSLEDAVRFYAQRDTQPQKWYPRKADGTVDKFDDLPTQYRANVNMEPPFGGKPG
DKPVLSEADVRDIVAFLKTLTDGYRPVRATQSGSQGGSRVAQR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtgtgctgcccgctgcaacgtttcgcgtgatcgccgtatcggcgcttgccggc
gtggtcgtcgtgttgtgcgggtgcgggcggggcgatcctgcggcccatgccgcaaccgtg
gcggcttcggcaccagcagcggtggcgccatcgacggcggcgggcgtaaagcccgcagcg
gcccctgcctacgagaaagccttctacacgatgatggctacgcgccgcccgtcggtgcct
gcaatggcggcgcttggcaaggcgctgttcttcgatcctgccctgtctgcctcgggcaag
caggcctgcgccagctgccatagcccgacacatgcctatggcccaccgaacgatctgtcg
gtccagcttggcggcacgggcatgaacaagacgggcgtgcgcgcagcaccatcgctgcgc
tatctgcagaaggtgccgccgttctccgaacacttttacgagagcgacggcaacgactcg
gaagaccagggcccgaccggcggctacacgtgggatggccgcgtgtcgtccacgcacgac
caggcgcgcatcccgctgctgtcggggcacgagatggccaacggaacgcaggccagcgtc
gtggccaagctgcgcaatggccgccacgcgcagacgttccgccaggtattcggcaacgac
atcctcgacaacgaagacaccgccttccgcgcggcactgatggtgctcgaggtcttccag
gaaacaccgtccgagttctatccgtatgacagcaagtacgacgcgttcttgcgcaagcag
gtgaagctgtcgccgcaggagttgcgcgggctgaaggcgtttgccgatccggccaagggc
aactgcgcgtcgtgccacgtgagcgccatcaagcaggacggggcgttcccggccttcacc
gattttggccacatcgccgtgggcgtgccacgcaatcgctcgctggccgccaatgcggat
ccgaagttcttcgacctgggcctgtgcggccccgaccggaccgatctcaaagaccgcacg
gactattgcggccgcttccgcacgccgtcgctgcgcaacgtggcgctgcgcaagacgttc
ttccacaacggcgccatccactcgctggaagacgcggtgcgcttctacgcccagcgcgac
acgcagccgcagaagtggtacccgcgcaaggctgacggcacggtcgacaagttcgatgat
ctgccgacccagtaccgcgccaacgtcaacatggagccgccgtttggcggcaagccgggc
gacaagcctgtgctgtccgaggccgacgtgcgcgacatcgttgcgtttctcaagacgctc
accgacggctatcgccccgtgcgggcgacgcaatccggcagccaaggcggcagccgcgtc
gcacagcgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system