KEGG   Ralstonia pickettii 12J: Rpic_4357Help
Entry
Rpic_4357         CDS       T00762                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpi  Ralstonia pickettii 12J
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:rpi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rpi00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rpi00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:rpi00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:660454..660819
Genome map
AA seq 121 aa AA seqDB search
MANNNIGPKRLVVGAHYGLKDFLAQRVTAVIMAVYTVVLLAAFLLSKDTSYQSWAGLFSN
QWMKMLTFLAFVSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataacaatattggtcccaagcgcctcgttgtgggcgcgcactacggcctgaag
gacttcctcgcgcagcgcgtcaccgccgtgatcatggcggtctacaccgtcgtgctgctg
gcggcgttcctgctctcgaaagacacgtcgtaccaaagctgggcggggctgttctccaac
cagtggatgaagatgctgacgttcctggcgttcgtgtcgctcacgtatcacgcctggatc
ggtgtgcgtgacatctggatggactacgtgaagcccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgtgcgggctacgcagctcagattctctggagg
gtttaa

DBGET integrated database retrieval system