KEGG   Ralstonia pickettii 12J: Rpic_4437Help
Entry
Rpic_4437         CDS       T00762                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00010  Glycolysis / Gluconeogenesis
rpi00071  Fatty acid degradation
rpi00350  Tyrosine metabolism
rpi00625  Chloroalkane and chloroalkene degradation
rpi00626  Naphthalene degradation
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01130  Biosynthesis of antibiotics
rpi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic_4437
  Lipid metabolism
   00071 Fatty acid degradation
    Rpic_4437
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rpic_4437
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rpic_4437
   00626 Naphthalene degradation
    Rpic_4437
Enzymes [BR:rpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rpic_4437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ACD29531
UniProt: B2UIY0
Position
2:743449..744459
Genome map
AA seq 336 aa AA seqDB search
MPESMQAMVMEGAGKPLIWRDVPMPTPGPGEVRIAVSACGVCRTDLHIVDGELTTPKPSL
IPGHEIVGIVESCGEGVTAPTPGERVGVPWLGWTCGVCPYCLHGRENLCDHPAFTGYTRD
GGYAQYAVCDARYCLPIPARYDDAHAAPLLCAGLIGYRTLRMAGDARRIGIYGFGAAAHL
ITQIAVAEQREVFAFTRTGDTAAQHLALDTGASWAGASDTPAPEQLDAALIFAPIGALVP
QALQAVVKGGSVVCGGIHMSDIPAFPYRLLWEERKLVSVANLTRADGLALMRIAAEVPLR
VHVTPYPLQDANTALEDLRAGRVAGAAVLQVPSKDL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatcgatgcaggccatggtgatggaaggtgccggaaagccattgatctggcgt
gatgtgcctatgcccacgcctgggcccggtgaggtccggatcgcggtgtccgcgtgtggc
gtctgccgtacggacctccatatcgtagacggtgaactgaccaccccaaaaccctccctg
attcccggccacgaaatcgtaggcatcgtcgagtcatgcggcgaaggcgtgacggcgccc
accccgggcgagcgcgttggcgtgccgtggctcggctggacgtgcggcgtctgcccgtac
tgcctgcacgggcgcgaaaacctgtgcgaccaccctgccttcaccggctacacgcgcgat
ggcggctatgcgcaatacgccgtttgcgacgcccggtactgcctgccgattcccgcgcgg
tacgacgacgcccacgccgcgccgctgctctgtgcggggctgatcggctaccgcacgctg
cgcatggccggcgatgcacgcaggatcggcatctacggctttggcgctgcggcccacctc
atcacgcagatcgccgtggcggagcagcgcgaggtcttcgccttcacccgcaccggtgac
actgcggctcaacatcttgcgctggacaccggtgccagttgggcaggcgccagcgacacc
cccgcaccggaacagctcgacgccgcgttgatcttcgcgcccatcggcgcgctcgtgccg
caggcgctgcaggccgtggtcaagggcggctcggtggtttgcggcggcattcacatgagc
gacatcccggcatttccgtaccggttgctatgggaagagcgcaagcttgtctccgtcgca
aacctgacgcgggccgatggactcgcgctcatgcgcatcgcggcggaagtcccgttgcgg
gtgcacgtcacgccctatccgctgcaagacgccaacaccgccttggaagacctccgcgcc
ggacgcgtggcgggcgctgccgtcctgcaggtgccgtcgaaagacctttga

DBGET integrated database retrieval system