KEGG   Ralstonia pickettii 12J: Rpic_4437Help
Entry
Rpic_4437         CDS       T00762                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rpic_4437
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic_4437
  Lipid metabolism
   00071 Fatty acid degradation
    Rpic_4437
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rpic_4437
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rpic_4437
   00626 Naphthalene degradation
    Rpic_4437
Enzymes [BR:rpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rpic_4437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:743449..744459
Genome map
AA seq 336 aa AA seqDB search
MPESMQAMVMEGAGKPLIWRDVPMPTPGPGEVRIAVSACGVCRTDLHIVDGELTTPKPSL
IPGHEIVGIVESCGEGVTAPTPGERVGVPWLGWTCGVCPYCLHGRENLCDHPAFTGYTRD
GGYAQYAVCDARYCLPIPARYDDAHAAPLLCAGLIGYRTLRMAGDARRIGIYGFGAAAHL
ITQIAVAEQREVFAFTRTGDTAAQHLALDTGASWAGASDTPAPEQLDAALIFAPIGALVP
QALQAVVKGGSVVCGGIHMSDIPAFPYRLLWEERKLVSVANLTRADGLALMRIAAEVPLR
VHVTPYPLQDANTALEDLRAGRVAGAAVLQVPSKDL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatcgatgcaggccatggtgatggaaggtgccggaaagccattgatctggcgt
gatgtgcctatgcccacgcctgggcccggtgaggtccggatcgcggtgtccgcgtgtggc
gtctgccgtacggacctccatatcgtagacggtgaactgaccaccccaaaaccctccctg
attcccggccacgaaatcgtaggcatcgtcgagtcatgcggcgaaggcgtgacggcgccc
accccgggcgagcgcgttggcgtgccgtggctcggctggacgtgcggcgtctgcccgtac
tgcctgcacgggcgcgaaaacctgtgcgaccaccctgccttcaccggctacacgcgcgat
ggcggctatgcgcaatacgccgtttgcgacgcccggtactgcctgccgattcccgcgcgg
tacgacgacgcccacgccgcgccgctgctctgtgcggggctgatcggctaccgcacgctg
cgcatggccggcgatgcacgcaggatcggcatctacggctttggcgctgcggcccacctc
atcacgcagatcgccgtggcggagcagcgcgaggtcttcgccttcacccgcaccggtgac
actgcggctcaacatcttgcgctggacaccggtgccagttgggcaggcgccagcgacacc
cccgcaccggaacagctcgacgccgcgttgatcttcgcgcccatcggcgcgctcgtgccg
caggcgctgcaggccgtggtcaagggcggctcggtggtttgcggcggcattcacatgagc
gacatcccggcatttccgtaccggttgctatgggaagagcgcaagcttgtctccgtcgca
aacctgacgcgggccgatggactcgcgctcatgcgcatcgcggcggaagtcccgttgcgg
gtgcacgtcacgccctatccgctgcaagacgccaacaccgccttggaagacctccgcgcc
ggacgcgtggcgggcgctgccgtcctgcaggtgccgtcgaaagacctttga

DBGET integrated database retrieval system