KEGG   Ralstonia pickettii 12J: Rpic_4618Help
Entry
Rpic_4618         CDS       T00762                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00362  Benzoate degradation
rpi00620  Pyruvate metabolism
rpi00621  Dioxin degradation
rpi00622  Xylene degradation
rpi00650  Butanoate metabolism
rpi01100  Metabolic pathways
rpi01120  Microbial metabolism in diverse environments
rpi01220  Degradation of aromatic compounds
Module
rpi_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic_4618
   00650 Butanoate metabolism
    Rpic_4618
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpic_4618
   00622 Xylene degradation
    Rpic_4618
   00621 Dioxin degradation
    Rpic_4618
Enzymes [BR:rpi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Rpic_4618
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Rpic_4618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ACD29703
UniProt: B2UJF2
Position
2:complement(946281..947216)
Genome map
AA seq 311 aa AA seqDB search
MTQKIKCALIGPGNIGTDLLAKLQRSPVLEPVWMVGIDPESDGLRRAREMGIKTTAEGVD
GLLPHVLADGVQIAFDATSAYVHAENSRKLNALGVLMIDLTPAAIGPYCVPPVNLKEHLG
RAEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSRSVGPGTRKNIDEFTRTTAG
AVERVGGAKKGKAIIVINPAEPPLIMRDTVHCLTETEPDQAAITASIQAMIKEVQKYVPG
YKLVNGPVFDGNRVSVFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEMIKGELNLR
AGTAASATETA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaagatcaaatgcgccctgatcggccccggcaacatcggcaccgatctgctg
gccaagctgcagcgcagccccgtgctggaaccggtatggatggtgggcatcgatcccgaa
tccgacggcctcaggcgtgcgcgcgagatgggcatcaagaccaccgccgaaggcgtggac
ggcctgctgccccacgtgttggccgacggcgtgcagattgccttcgatgccaccagcgcc
tacgtgcatgccgagaactcacgcaagctcaacgcgctgggcgtgctgatgatcgacctc
acacctgcggccatcggcccgtactgcgtgccgccggtcaacctcaaggagcatctgggc
cgcgcagagatgaacgtcaacatggtgacctgcggcgggcaagcgaccatcccgatggtg
gcggcagtcagccgcgtgcagcccgtggcgtatggcgagatcgttgccacggtgtcgagc
cggtcggtggggccgggcacccgcaagaacattgatgaattcacgcgtaccacggccggt
gcggtcgagcgtgtgggcggagcgaagaagggcaaggccatcatcgtcatcaacccggct
gagccgccgctgatcatgcgcgacaccgtgcattgcctgacggaaaccgagccggatcag
gcggccatcaccgcgtcgatccaggcgatgatcaaagaggtgcagaagtacgtgccgggc
tacaagctcgtcaacggcccggtgttcgacggcaaccgcgtgagcgtgttcctggaggtc
gagggcctgggcgattacctgcccaagtacgccggcaacctcgacatcatgaccgccgca
gccgcgcgcacggccgagatgtttgccgaggagatgatcaagggcgaactgaacctgcgc
gccggcacggccgcgtctgccactgaaaccgcctga

DBGET integrated database retrieval system