KEGG   Ralstonia pickettii 12J: Rpic_4647Help
Entry
Rpic_4647         CDS       T00762                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00010  Glycolysis / Gluconeogenesis
rpi00020  Citrate cycle (TCA cycle)
rpi00620  Pyruvate metabolism
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01130  Biosynthesis of antibiotics
rpi01200  Carbon metabolism
Module
rpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic_4647
   00020 Citrate cycle (TCA cycle)
    Rpic_4647
   00620 Pyruvate metabolism
    Rpic_4647
Enzymes [BR:rpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rpic_4647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: ACD29732
UniProt: B2UJI1
Position
2:977530..978657
Genome map
AA seq 375 aa AA seqDB search
MIAFRLPALGADMDEGTLLEWQVKPGDTVKKGQIIAVVDTSKAAIDVESWHEGTVAELLV
TPGTKIPVGTPMAMFLEPGEAPGAVKRQPDMPGAARPLPPPQTRRMASPAARQAARERGI
DIDTITGTGHGGVITLADVEHATPVGSAVTGDRAADIRKTIAAAMTRSKREIPHYYVAET
IPLAAMLAWLAQENTRRPITERLLPAAVLIKAVALSLRQFPELNGFYRDGAFEAAEAVHI
GVAISLRQGGLMAPALLDAHAKPLTQLMQELTDLVRRCRAGTLKSSEMSAPTVTVTNLGD
QGVAQVFGIIYPPQVALVGFGRIAEQPWAEAGGLKIMPAVTASLSADHRVSDGHRGARFL
SELSDRLQHPEALDR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgttccgactgcccgcgctgggggccgacatggacgagggcacgctactggag
tggcaggtcaaacccggcgataccgtgaagaagggccagatcattgccgtggtcgacacc
agcaaggctgccatcgacgtcgagagctggcacgaaggcacggtagccgagctgctggtc
acgcccggcacgaagattccggttggaacgccgatggcaatgttcctggagcccggcgag
gcgccaggcgccgtcaagcgccagccggacatgccgggcgcggcgcgtcccctgccgccg
ccgcagacgcgccgcatggcttcacccgcagcacggcaggctgcacgcgagcgcggcatc
gacatcgacaccatcaccggtaccggccacggcggggtcatcacgctggccgacgtcgag
cacgccacgccagttggcagcgcggtcacgggtgacagagccgccgacatccgcaagacc
attgccgccgccatgacgcgctccaagcgcgagataccgcattactacgtggccgagacg
atcccgctggcggccatgctggcctggcttgcccaggagaacacgcggcgccccatcacg
gagcgcctgttgccggcagccgtcctcatcaaggcggttgcgctgtcgctccggcaattt
cccgaactcaacggcttctatcgcgatggggcattcgaggcagccgaagccgtgcacatc
ggcgtggcgatttcattgcggcaaggcgggctgatggcgcccgcgctgctggatgcccac
gccaagccactcactcagctgatgcaggaactgaccgacctggtcaggcgctgccgggcg
ggcacgttgaaaagctctgagatgtcggcgcccaccgtcactgtcaccaacctcggtgac
cagggtgtggcgcaggtgttcggcatcatctatccaccgcaggtggcgctggtgggcttc
ggccgcatcgccgagcagccatgggccgaagcgggtggactgaagatcatgccggctgtc
accgccagcctgtcggcggatcaccgggtctccgacgggcatcggggcgcccgctttctc
tccgaactcagcgaccggctacaacatccggaggcgctcgaccgatga

DBGET integrated database retrieval system