KEGG   Ralstonia pickettii 12J: Rpic_4865Help
Entry
Rpic_4865         CDS       T00762                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic_4865 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic_4865 (glk)
   00052 Galactose metabolism
    Rpic_4865 (glk)
   00500 Starch and sucrose metabolism
    Rpic_4865 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Rpic_4865 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rpic_4865 (glk)
   00524 Butirosin and neomycin biosynthesis
    Rpic_4865 (glk)
Enzymes [BR:rpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rpic_4865 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1212464..1213519)
Genome map
AA seq 351 aa AA seqDB search
MSIGLHEVNAGTDADVTAYPRLVADVGGTNVRFALEMAPMRLAHIGVLAGDDYPSLESAM
RAYLASLPPEIASAGVRHAAIGIANPVLGDQIRMTNRDWAFSIEAMRQSLGFDTFVVIND
FAALAHALPYLPADELEQVGGDASLADAPRALLGAGTGLGVASLLPTPDGRYIAVAGEGG
HVAFPPMNDEEVAIWRFARERFGHVSAERLISGMGLELIYEALGACFDLWQQGPAVRRAA
DITAIALGEMEDAAGDHARCRYAVDTFCAFLGTIAANLAVTLGARGGVYIGGGIVPRLGP
AFANSPFRRRFEDKGRFSSYVAAMPVYVIHSPYPGLIGLCAAMDHAVAQGH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctattggactgcatgaagtgaacgcgggcactgacgcagatgtcacggcctacccg
cgcctggtggccgacgtgggcggcaccaacgtgcgcttcgcgctcgagatggcgccgatg
cgccttgcgcacatcggtgtgctggccggcgacgattatccatcgctcgaatccgccatg
cgtgcgtatctggcgtcgctgccgcccgagattgcgtcggccggcgtgcgccatgcggcc
atcggtatcgccaatccggtgctgggcgaccagatccgcatgaccaaccgcgactgggcc
ttctcgattgaagcgatgcggcagtcgctgggtttcgacaccttcgtcgtgatcaacgac
tttgccgcactggcccatgcactgccgtacctgccggccgatgagctggaacaggtgggt
ggcgacgccagccttgccgatgcgccgcgcgccctgctcggcgcgggcacgggcctgggc
gtggcctcgctgctgccgacgcccgacggccgctacatcgccgtcgcgggcgagggcggc
cacgtggccttcccgcccatgaatgacgaggaagtggccatctggcgctttgcgcgcgag
cgctttggccacgtctctgcggagcggctcatctcgggcatggggctggaattgatctac
gaggcgctgggtgcgtgcttcgacttgtggcagcaaggcccggccgtacggcgcgccgcc
gacatcaccgccattgcgctcggcgagatggaagatgcggcaggcgatcatgcgcgctgc
cgctacgccgtcgatacgttctgcgcttttctcggcaccatcgcagccaacctggccgtg
acgctgggtgcgcgcggtggcgtgtacatcggcggggggatcgtcccaaggcttggcccg
gcgttcgccaactcgccgttccggcggcgctttgaagacaagggccgcttctcgtcctat
gtagcggcgatgccggtgtatgtcatccactcgccatacccggggctgatcggcctgtgc
gcggcgatggaccacgcggtggcacaggggcattga

DBGET integrated database retrieval system