KEGG   Ralstonia pickettii 12J: Rpic_4929Help
Entry
Rpic_4929         CDS       T00762                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00071  Fatty acid degradation
rpi00280  Valine, leucine and isoleucine degradation
rpi00281  Geraniol degradation
rpi00310  Lysine degradation
rpi00362  Benzoate degradation
rpi00380  Tryptophan metabolism
rpi00410  beta-Alanine metabolism
rpi00640  Propanoate metabolism
rpi00650  Butanoate metabolism
rpi00903  Limonene and pinene degradation
rpi00930  Caprolactam degradation
rpi01040  Biosynthesis of unsaturated fatty acids
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01130  Biosynthesis of antibiotics
rpi01200  Carbon metabolism
rpi01212  Fatty acid metabolism
Module
rpi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpic_4929
   00650 Butanoate metabolism
    Rpic_4929
  Lipid metabolism
   00071 Fatty acid degradation
    Rpic_4929
   01040 Biosynthesis of unsaturated fatty acids
    Rpic_4929
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpic_4929
   00310 Lysine degradation
    Rpic_4929
   00380 Tryptophan metabolism
    Rpic_4929
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpic_4929
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rpic_4929
   00281 Geraniol degradation
    Rpic_4929
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpic_4929
   00930 Caprolactam degradation
    Rpic_4929
Enzymes [BR:rpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rpic_4929
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rpic_4929
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rpic_4929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 AlaDh_PNT_C DAO NAD_binding_8 UDPG_MGDP_dh_N F420_oxidored ApbA 2-Hacid_dh_C NAD_Gly3P_dh_N DUF2680
Motif
Other DBs
NCBI-ProteinID: ACD30013
UniProt: B2UKB2
Position
2:1279970..1282096
Genome map
AA seq 708 aa AA seqDB search
MIDITIDTDGIATLTWNQPGRAQNVLNGDTCAAFFAAIDRVCADASVKGILVTSAKADFI
AGGDLEWLQASDDAATLFDRTCELHRMLRKLETCGKPVAAALPGSTLGGGLEIALACHYR
VAADNARARFGLPEVTLGLLPGGGGTQRLPRLIGVQKALPMLLEGKRIKAADALKLGIVD
AVVNAGEEADAARTWLLGDGQTRAQQPWDIKGYKVPGGGIASPAVQQLFTAANAMLRQKT
YGNYPAAASILSCVYEGLITDLDTGLKTEARYFVQAVLSPEARAMIRTLFFSLNAANKLA
ARPADVPVRRYAKVGVLGAGMMGAGIAYVTAKAGVPVVLLDTTQEAAERGKDYSRKLVEK
QVQRGRLHAEQAEALLARIKPTTSYADLDGAGLIVEAVFEQREIKADVTRMAEAVISPDA
IFASNTSTLPITGLAEASQRPGNFIGLHFFSPVDKMPLVEVIVARQTTRATLAQALDYVK
AIGMTPIVVNDSRGFYTSRVFSTYVLEGLAMLAEGVAPALIENAGLQAGMPVGPLALIDE
VSSELIHKVNQQTRADLGVAYIERPGEAVAERMVALGRIGRKAGQGFYDYPEGGRKALWP
GLAAEYPPAATQPDVQTLVDRLITVQAVETARCLDEGVVTDPRDADVGALLGWGFPAFRG
GPVSHIQRVGVDAFVEQCDRLAADHGRRFAPPKLLRDMAEQHAVFYTR
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacatcaccatcgacaccgacggcatcgccacgctcacgtggaaccagccgggc
cgcgcgcagaacgtgctcaacggcgacacctgcgccgccttttttgccgccatcgaccgc
gtatgcgccgatgccagcgtcaagggcattctcgtcacctcggccaaggcggatttcatt
gccggcggcgacctcgaatggctgcaggccagcgacgacgcagccacgttgtttgatcgc
acgtgcgagctgcaccgcatgctgcgcaagctggaaacctgcggcaaacccgtggccgcc
gcgctgccgggctccacgctgggcggcgggttggagattgcgctcgcctgccactaccgc
gtggcggccgacaacgcccgcgcgcgctttggcctgccggaagtcacgctgggcctcttg
ccgggtggcggcggcacgcagcgtctgccgcgcttgattggtgtgcagaaggcgctgccg
atgctgctggaaggcaagcgcatcaaggcggccgacgcgctcaagctcggcattgtcgat
gcggtcgtcaatgcgggcgaggaagccgatgccgcgcgcacgtggctgctgggcgacggc
cagacccgcgcgcagcagccgtgggacatcaagggctacaaggtgcccgggggcggcatc
gccagccccgccgtgcagcagctattcacggcggccaacgccatgctgcggcagaagacc
tacggcaactatccggcagcggcgagcatcctgtcgtgcgtgtacgaagggctcatcacc
gatctcgatacgggcctcaagaccgaggcgcgctacttcgtgcaggcggtgctgtctccg
gaagcccgcgcgatgatccgtacccttttcttcagcctgaacgccgccaacaagctggcc
gcgcgcccggccgatgtgccggtgcggcgctacgccaaggtgggcgtgctcggtgccggc
atgatgggtgcgggcattgcctatgtcaccgccaaggcgggggtgcccgtcgtgctgctc
gacaccacgcaagaagctgccgaacgcggtaaagactattcacgcaagctcgtcgagaaa
caggtacagcgcggccgcctgcatgccgagcaggccgaagcgctgctcgcccgcatcaaa
ccgaccacctcatacgcggacctcgacggcgcgggcctcatcgtcgaggccgtattcgag
cagcgcgagatcaaggccgacgtcacgcgcatggccgaagccgtgatctcgccggacgcc
atcttcgcgtccaacacctccacgctgccgattaccgggctggcggaggcgagccagcgg
ccgggcaacttcatcgggctgcatttcttctcgccggtcgacaagatgccgctggtggag
gtgatcgtcgcccggcagaccacgcgggccacgctggcgcaggcgctcgattacgtgaag
gccatcggcatgacgcccatcgtcgtcaatgacagccgagggttctatacgagccgcgtg
ttctcgacctacgtgctcgaaggcctggcgatgctcgccgaaggcgtggcacccgcattg
atcgagaatgccgggctgcaggccggcatgccggtcgggccgctcgcgctgatcgacgaa
gtctcgagcgagctgatccacaaggtcaaccagcaaacccgcgccgacctgggtgtcgcc
tacatcgagcgccccggcgaagccgtggccgagcgcatggtggcgctgggccgcatcggc
cgcaaggcaggccagggcttctacgactaccccgaaggcggcaggaaggcgctctggccg
ggcctggccgccgagtatccgccggccgccacgcaacctgacgtgcagaccctcgtcgac
cggctgatcacggtgcaggccgttgaaaccgcacgctgtctcgacgaaggcgtggtcacc
gacccgcgcgatgccgatgtcggtgcgctgctgggttggggattcccggctttccgcggc
ggcccggtctcgcatatccagcgcgtgggcgtcgacgcgtttgtcgagcagtgcgatcgt
ctggccgccgaccatggccgccgctttgcgccgcccaagctgctgcgggatatggcggaa
cagcacgcggtgttctatacgcggtag

DBGET integrated database retrieval system