KEGG   Rickettsia peacockii: RPR_00115Help
Entry
RPR_00115         CDS       T00907                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpk  Rickettsia peacockii
Pathway
rpk00010  Glycolysis / Gluconeogenesis
rpk00020  Citrate cycle (TCA cycle)
rpk00620  Pyruvate metabolism
rpk01100  Metabolic pathways
rpk01110  Biosynthesis of secondary metabolites
rpk01120  Microbial metabolism in diverse environments
rpk01130  Biosynthesis of antibiotics
rpk01200  Carbon metabolism
Module
rpk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPR_00115
   00020 Citrate cycle (TCA cycle)
    RPR_00115
   00620 Pyruvate metabolism
    RPR_00115
Enzymes [BR:rpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RPR_00115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACR47032
UniProt: C4K0D0
Position
complement(20164..21402)
Genome map
AA seq 412 aa AA seqDB search
MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV
IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLPKPHENITNVEEQ
VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPNTAHNKIVSR
NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFSEDKSTR
ISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVTPIVKNANQKN
ILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGAS
AKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLMLI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttatctccaactatgacggaaggaaatctagct
aggtggttaaaaaaagaaggggacaaagttaatcctggagaagtaattgctgaaattgaa
accgataaagcaacgatggaagtagaagcagtagacgaaggtatacttgccaaaatagtt
atcccacaaaatagtcaaaatgtacctgttaactctttaattgccgtgttaagtgaagag
ggagaagaaaaaacagacattgatgcgtttattgcaaaaaataatagtgtatcaccgtca
ccgaaaacagatgctaatcttccgaaaccccacgagaatataactaatgtagaagaacag
gtaacagttataaaacatgatgctagtaaaatattcgcctcaccgcttgcaaaaagactt
gcaaaaatgagaaatattagatttgagagcgtgaaaggtagcggtccgcacggtagaata
gtcaaacaagatatcttatcatatactcctaacactgctcataataaaatagttagcaga
aatcctgaagaatatcgtttagtaccaaataataatatccgcaagattatagccaagcgt
ctgcttgaatctaaacaaacagttccacatttttatttatctatagaatgtaatgtcgat
aaattgttagatataagagaagacattaataaatctttttctgaagataaatcaacaagg
atatcggttaatgattttattattttagcagtagccaaagctttacaagaagtgccaaat
gccaatgctagctggggagaagatgcaattagatattacaataatgtcgatatttcagta
gcggtagcgattgagaacgggcttgttacaccgatagttaaaaatgccaatcaaaaaaac
attctagaactatctcgtgaaatgaaagcattaataaagaaagcaaaagataataaatta
acccctgaagaatttcagggcggagggtttaccatttctaacctcggtatgtacggtatt
aagaatttcaatgctataattaacccaccacaaagttgtataatgggcgtcggagctagt
gcaaaacgtgctatagtcaagaatgatcaaataactatagcaacaattatggacgtaact
ctttctgccgatcaccgagtagtagacggagcagtcggtgctgagttcttggcagcattt
aaaaagtttatagagagtcccgttttgatgttgatataa

DBGET integrated database retrieval system