KEGG   Rickettsia peacockii: RPR_02090Help
Entry
RPR_02090         CDS       T00907                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpk  Rickettsia peacockii
Pathway
rpk00020  Citrate cycle (TCA cycle)
rpk00310  Lysine degradation
rpk01100  Metabolic pathways
rpk01110  Biosynthesis of secondary metabolites
rpk01120  Microbial metabolism in diverse environments
rpk01130  Biosynthesis of antibiotics
rpk01200  Carbon metabolism
Module
rpk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPR_02090
  Amino acid metabolism
   00310 Lysine degradation
    RPR_02090
Enzymes [BR:rpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPR_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACR47267
UniProt: C4K116
Position
346016..347203
Genome map
AA seq 395 aa AA seqDB search
MRVKIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS
KTDGANIAVGEEIGEINEGASVNTAGTNNESARAQAVTQPTSEKPAVANNTLAPSVQKLV
TENKLDPNNIKGTGRDGRITKGDVLATINTTTTSAPAISKSNEERVQRVRMSRLRKTIAQ
RLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIEALKLIP
SVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKTIGILAKQAREGK
LSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIHPMMYI
ALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaaaattatagtaccgtcgcttggggagtccataacggaagcaactattgcc
aaatggtataagaaagaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagttaatgctccttgcaatggtactataggtaaaatatcg
aaaactgacggtgcaaatatagcagttggcgaagaaataggcgaaataaatgaaggagca
tctgtaaatactgccggtactaataatgaatctgctagagctcaagcagtaacacaacct
acttcagaaaaacctgccgtggctaataatactcttgctccttctgtacaaaaattagtt
accgaaaataagcttgaccccaataatataaaaggaacaggtagagacggtagaattacc
aaaggtgacgtgcttgcaacaataaacactacgactacttctgctcctgcaataagtaaa
tctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgtaaaactattgcacag
cgtttaaaagattcacaaaatacagcagctattttgactacttttaatgaaatcgatatg
tcaaaagtaattgctttgcgtaatcaatataaagaagagtttgagaaaaagcacgctgtg
aaacttgggtttatgtctttctttgttaaagcaacaattgaagctttaaagcttattccg
tcggtaaatgctgaaatagatggcgatgatttagtatataaaaattactatgatataggt
gtagctgtcggcacagagcaagggcttgttgtaccggttgttagggatgccgataaaatg
ggatttgccgaagtggagaaaactataggaattttggctaaacaagctcgtgagggtaag
ctttctatggctgatttgtcaggtgggacattctcgatttctaacggaggcgtatatggc
tcattattatctacaccgattattaatcctcctcaatcaggtattctaggcttacataaa
accgaggaaagagctgtagttatagacggtaaaattgaaatacatccgatgatgtatata
gctttatcttacgatcatcgtataattgatgggaaagaaggagtatcgttcttggtaaaa
attaagcagcttattgagaatcctgaaaagttattgttaaatttgtaa

DBGET integrated database retrieval system