KEGG   Rickettsia peacockii: RPR_02170Help
Entry
RPR_02170         CDS       T00907                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rpk  Rickettsia peacockii
Pathway
rpk01100  Metabolic pathways
rpk01120  Microbial metabolism in diverse environments
rpk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPR_02170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 SDF Senescence_reg
Motif
Other DBs
NCBI-ProteinID: ACR47281
UniProt: C4K130
Position
complement(359943..360470)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSENQNTTALEQ
APVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacatcgc
ggctacagcgttgcggttcaagaatcatcagaaaatcaaaatactaccgcactagagcaa
gcaccggtaaatataccggaattaatgaagactgccaacgccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgctttcttacataaa
ccaagtagctatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system