KEGG   Rickettsia peacockii: RPR_02365Help
Entry
RPR_02365         CDS       T00907                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rpk  Rickettsia peacockii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rpk01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rpk01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(396815..398008)
Genome map
AA seq 397 aa AA seqDB search
MLSKLNKSALFALIFYPIFIISLVVKYSFDYGIGLTEVIFIIASYYINNITVGIGLHRLW
SHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQDQDPHTPLKFDNKFLGF
MWSHIGWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQIAAFMNIVVPLFIGYLVGG
TMQSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKKYYKGTAGDIWWMALFLLGENWHN
YHHAFPSDYRNGAKWYHLDIHKWIIFLMSKIGLASELERTTKVRIQAKMQETLSYLSEKQ
KQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSFVEIQESLKNLAEQVSAATQI
TEKSSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKVSN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataagtccgctttatttgctttaatattttatcctatttttatt
atatctcttgtagttaaatattcgtttgattatggaatagggctaactgaagttattttt
ataattgctagttattatattaataatattaccgttgggatcggtttgcataggttatgg
tctcataatgcctataaaataaataaatatgccgagtttgtcttaattatgctgtctgca
ggaacattacaaggaccagctttatcttgggcatcgaatcattataaacatcatagatat
acggatcaagaccaagatccgcatactcctttaaaatttgataataaatttttaggcttt
atgtggtctcatataggatggatgctagtcggaagcggtagctataagtctattgatcgc
attacttgggctaagcacgggaaaaacaatttattaaaatggcagctaaaatattattgg
caaatagcagcttttatgaatattgtcgtgcctttatttatcggttacttagtcggtggt
actatgcaatcggcatatgcaggatttttatttatggggctcggtagattcctacagcag
caagcaaccttctgcgttaattctttatgccactttgccggtagtaaaaaatattacaaa
ggcactgccggagatatttggtggatggcattattcttactcggtgaaaattggcataat
taccatcatgcttttccttcagattatcgtaacggtgcaaaatggtatcatttggacatt
cacaaatggataatatttttaatgagtaaaatcggtttagcttcagaacttgaacgtact
acaaaagtacgtatacaggcaaaaatgcaagaaactttaagctatcttagtgaaaaacaa
aagcaaaaattgactttaatgcaaactaaaatagatcatttattagaaaatctatgctta
aaaattaaagagcttgaagaatcatctattactatcaaagaacaatttaaaaaatctttt
gtagaaatacaagaatcacttaaaaatttagcggagcaagtaagtgctgcaacgcaaata
acagaaaaatcttcggaaaaactattaaaaatagttaataaaaaaattattgatgccgaa
caatctatttataagctgtataatcaattaaataccttaaaggtatctaattag

DBGET integrated database retrieval system