KEGG   Rickettsia peacockii: RPR_04015Help
Entry
RPR_04015         CDS       T00907                                 

Definition
succinate dehydrogenase membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpk  Rickettsia peacockii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPR_04015
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPR_04015
   00650 Butanoate metabolism
    RPR_04015
  Energy metabolism
   00190 Oxidative phosphorylation
    RPR_04015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(677820..678197)
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA
LFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgtgggaa
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaagattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgttactattgtagcttttgtagtagcg
ctgttttataaaggataa

DBGET integrated database retrieval system