KEGG   Rickettsia peacockii: RPR_06420Help
Entry
RPR_06420         CDS       T00907                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rpk  Rickettsia peacockii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rpk03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081217..1082038
Genome map
AA seq 273 aa AA seqDB search
MPELPEVETLKNSLKDKLIGLIIENVELKRDNLRYKLSPLLATEILNTNILDVRRRAKYL
IIDFNNDYSLIVHLGMNGRFTLQSANYKTQKHDHVIFDLSNGEKLIFNDTRRFGMIYSFK
TDLLEKEFFNDLGIEPFSDLLTLEYLKDKLQTKKIPIKNLIMDNRVIVGVGNIYASESLH
LARIHPDKSGNDLRDDEIENLIKAIRDVLTKAITAGGTTLKDFVNGDNKPGYFTKQLKVY
GREGQSCLSCSSTIIKIKHSGRSTFYCKTCQYS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacttcctgaagtagaaactcttaaaaactctctaaaagataagctaatcggg
cttattatagaaaatgtagagttaaaaagagataatttacgttataagctatccccgctt
ttagctacagaaatcttaaatactaatatactggatgttaggcgtcgtgcaaaatattta
attatagattttaataatgattattctttaatagttcatctaggcatgaacggcagattt
actctgcaatctgctaattataaaactcaaaaacacgatcatgtgatttttgatttaagt
aacggcgaaaagttaattttcaacgatactagacgattcggtatgatttatagttttaag
actgatctcttagaaaaagaattttttaatgatttaggcatagagcctttttctgattta
ttgacgttagaatatctaaaagataagctacaaactaaaaaaataccaataaaaaacttg
attatggataatagagttatagtcggagtcggtaatatctatgcttccgaaagtctgcat
ttagctagaattcatccggataaatcaggtaacgatttaagggatgatgaaatagaaaat
ttaattaaagcgattagagatgtgttaactaaagctataactgccggcggtactactctt
aaagattttgtaaacggcgataacaaacctggttattttactaagcaacttaaggtttac
ggtagagagggacaaagttgtttaagctgttctagcaccattatcaagataaagcattca
ggcagaagtactttttattgtaaaacttgccaatatagttaa

DBGET integrated database retrieval system