KEGG   Rickettsia peacockii: RPR_07315Help
Entry
RPR_07315         CDS       T00907                                 

Gene name
rph
Definition
ribonuclease PH (EC:2.7.7.56)
Orthology
K00989  
ribonuclease PH [EC:2.7.7.56]
Organism
rpk  Rickettsia peacockii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1223422..1224141)
Genome map
AA seq 239 aa AA seqDB search
MRQSGRKSNQLRPISLELSPLINAEGSCLIKIGNTHVMCSATCETTVPPFLRGQNQGWIT
AEYGMLPGSTSQRIKREAALGKQGGRTQEIQRLIGRAMRCVIDVRKLGERQIIIDCDVIN
ADGGTRTAAITGSYVALHLAIRSLMKKRVLKVNPLISQIAAISCGIYKGEAILDLDYLED
SDADVDSNFVFAGNGNLIEVQGTAEKNPFSEEQFLAMLKLAKGGAAELFKLQNQVLLGS
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagacagtcaggaagaaaaagcaaccaattacgtcctatttcattagaattatccccg
cttattaatgcggaaggttcatgtcttattaaaatcggtaatacacatgtcatgtgtagt
gctacttgtgaaactaccgtaccgccattcttgaggggacaaaatcaaggctggattact
gccgagtacggtatgcttcccggttctacatcacagcgtattaaaagagaagcggcactt
gggaaacaaggcggaagaacgcaagagatacagcgtttaataggtagggcgatgcgatgt
gtaattgatgtgaggaaacttggcgagaggcaaattatcatagattgtgatgttattaat
gctgacggcggtactagaactgcagcaataacagggagctacgtagcattgcacctagct
attaggtccttgatgaaaaagagagttttaaaggtgaaccctttaattagtcaaattgca
gctatttcttgcggtatatataaaggtgaggcgatactagatttggattatttagaagat
agtgatgcggacgtggatagtaattttgtgtttgcaggtaacggtaatttaatcgaagta
caaggcacggcagagaaaaatcctttttccgaagagcagtttttagcaatgttaaaactt
gctaaaggcggagctgcggaattatttaaactacaaaatcaggtactgcttgggtcttag

DBGET integrated database retrieval system