KEGG   Rickettsia peacockii: RPR_07625Help
Entry
RPR_07625         CDS       T00907                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rpk  Rickettsia peacockii
Pathway
rpk00230  Purine metabolism
rpk00240  Pyrimidine metabolism
rpk01100  Metabolic pathways
rpk03030  DNA replication
rpk03430  Mismatch repair
rpk03440  Homologous recombination
Module
rpk_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rpk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RPR_07625
   00240 Pyrimidine metabolism
    RPR_07625
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RPR_07625
   03430 Mismatch repair
    RPR_07625
   03440 Homologous recombination
    RPR_07625
Enzymes [BR:rpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RPR_07625
DNA replication proteins [BR:rpk03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RPR_07625
DNA repair and recombination proteins [BR:rpk03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     RPR_07625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ACR47922
UniProt: C4K2X7
Position
complement(1268640..1269104)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPH
GSKLDPQPEKQPIYITDELQNPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPE
DLKELTVKINKFTGQENKIDCFTQNPRGAWNKVV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcaaacaagcgatgaattgcttctaaaatcgatattgctt
ctgatagaaaaatgctatcactctgatcttaaaagcgtgatattaactgcagatgcagat
caacaagaaatgctcaataaaaatctttggacttattcacgtaagcaatttatacctcac
ggtagtaaacttgatccgcagcctgaaaaacagccgatttatattaccgatgagttacaa
aatcctaataatgctagtgtgcttgttattatttcgcctacagatataggaaaaatttta
caagcaaaagagtatataagagttttcaaaaggataattataataactgatttaccggaa
gatttaaaagaattaacagttaaaataaataaatttaccggacaggaaaacaaaatagat
tgttttactcaaaatcctcgtggagcttggaataaagtagtctaa

DBGET integrated database retrieval system