KEGG   Rickettsia prowazekii Breinl: H375_7880Help
Entry
H375_7880         CDS       T02543                                 

Definition
(GenBank) Poly-beta-hydroxybutyrate polymerase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpl  Rickettsia prowazekii Breinl
Pathway
rpl00071  Fatty acid degradation
rpl00280  Valine, leucine and isoleucine degradation
rpl00310  Lysine degradation
rpl00362  Benzoate degradation
rpl00380  Tryptophan metabolism
rpl00620  Pyruvate metabolism
rpl00630  Glyoxylate and dicarboxylate metabolism
rpl00640  Propanoate metabolism
rpl00650  Butanoate metabolism
rpl00900  Terpenoid backbone biosynthesis
rpl01100  Metabolic pathways
rpl01110  Biosynthesis of secondary metabolites
rpl01120  Microbial metabolism in diverse environments
rpl01130  Biosynthesis of antibiotics
rpl01200  Carbon metabolism
rpl01212  Fatty acid metabolism
rpl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H375_7880
   00630 Glyoxylate and dicarboxylate metabolism
    H375_7880
   00640 Propanoate metabolism
    H375_7880
   00650 Butanoate metabolism
    H375_7880
  Lipid metabolism
   00071 Fatty acid degradation
    H375_7880
   00072 Synthesis and degradation of ketone bodies
    H375_7880
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H375_7880
   00310 Lysine degradation
    H375_7880
   00380 Tryptophan metabolism
    H375_7880
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H375_7880
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H375_7880
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    H375_7880
Enzymes [BR:rpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H375_7880
Exosome [BR:rpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H375_7880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-GeneID: 15151553
NCBI-ProteinID: AGJ03013
Position
953564..954742
Genome map
AA seq 392 aa AA seqDB search
MTKQVYITHAKRTAFGSFMGSLSTIPAPMLAAYLIKDILQNSKIEPALVNEVILGQVITG
GSGQNPARQTLIYADIPQEVPGYTINKVCGSGLKSIALAANSIITCDNEIVIAGGQENMS
LGMHGSYIRAGSKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDAFAL
SSHKKAAKAQLSGILQDEILPIEVTVKKNTSLFDHDETVRHNTSIEILSKLRPAFDKNGV
VTAGNSSSINDGAACVLLVSEKALKKHNLTPLARIVSWASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRLLIT
LIHNLRRAKAKKGLVTLCIGGGIGISMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtcttagtacaattccagcaccaatgttagctgcttatttaatcaaggatatactgcaa
aatagtaaaatcgagcctgctttagtaaatgaggtaatacttggacaagtaataacaggt
ggtagtggacagaatccagcaagacaaactctgatttatgccgatataccgcaagaagtt
ccaggttatactattaataaagtatgtggctcaggtcttaaaagtatagcacttgcagca
aattcaattattacatgcgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
ctcggtatgcacggtagttatatcagagcaggatctaaattcggcgatatcaaaatggtt
gatctcatgcaatatgatggtttaatagatgtattttcaggagtatttatgggtattact
gccgaaaatatcgcgaagcagtttaatattagtcggcaagagcaggacgcattcgcctta
agttctcacaagaaagctgctaaagcacaattatcaggaattctacaagatgaaatcttg
cctatagaggtaacagttaaaaaaaatactagtttgtttgatcatgatgaaacagtaaga
cataatacaagcattgaaattcttagtaaattacgccctgcttttgataaaaatggtgta
gttacagctggtaactcttcctctattaatgacggtgcagcatgtgttctgcttgtttca
gaaaaagctttgaagaaacataatttaacaccgttagcgcgtattgtttcttgggcttca
gctggtgttgatccaagaattatgggtactgcacctgtacctgcatctaaaaaagcatta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcatttgca
gcacaaagtatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggtgcaagtggtggacgtcttcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtattggtatttctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system