KEGG   Rhodospirillum photometricum: RSPPHO_00025Help
Entry
RSPPHO_00025      CDS       T01851                                 

Definition
Hydrogenobyrinic acid a,c-diamide cobaltochelatase
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
rpm  Rhodospirillum photometricum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RSPPHO_00025
Enzymes [BR:rpm01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RSPPHO_00025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
89977..93762
Genome map
AA seq 1261 aa AA seqDB search
MASRASPSRRCMMQKPTSEADATPLRVVIVTLDGHLAGAVQRAQRMLRQDVPGLTLRMHA
AVEWGEDPEALARAKADIAQADIILATMLFLEDQIKAVLPDLQARRDKCHALVGCLAAGE
IVNLTKLGNFTFEGSDRGILSLLKRLKGDKNKAEKPTAGAGAQQMAMLRRLPRILRLIPG
KAQDLRAYFLTLQYWLAGSDDNLINMIRFLVDRYAAGPHAAYRGKVKAQPPVDYPDVGLY
HPRLPGRVTDRLDRLPPLEAQDAAKEVRGVVGVLVMRSYVLAGNTAHYDAVIKALESRGL
RVIPAYSSGLDNRPAVEEYFMRNGRATIDLMVSLTGFSLVGGPAYNDARSAEEILARLDV
PYMTTHAVEFQTLAQWEESPRGLMPVESTMMVAIPELDGCINPMLYGGRADDGEATEGPG
REMVAHPERVETLADRVARMVALRRTPPAERKVAIVLFNFPPNAGATGTAAYLSVYASLY
NTLKAMARAGYQVEVPESEDALRQRILGGNAAQFGAPANVHTRIRSDDHVRRERHLNDIE
AQWGPAPGRDLTDGASLFVLGVELGNVFIGIQPTFGYEGDPMRLLFEKGFSPTHAFSAFY
RYLRDDYAAHAVVHFGMHGALEFMPGKQSGLSGKCWPERLIGDLPNIYLYASNNPSEGSL
AKRRSAATLVTYLTPSVTEAGLHKGLLELKSSLERYRGLPPEADDERDRMVALIQAQAAE
VNLADPEPLWGDDARTRIERLVGQVLEVEETLIPHGLHVIGAPPGPAERLDLLMAVCDAS
HGTKPPRAALEALINGQSPAKALAAGGVGSDAKLREIFEDLARMNALLAEDHELPALLRA
LDGRYIHPAPGGDLLRTPAVLPTGRNMHGFDPWRLPSRFAVEDGRRLAAMILARHTQDGN
ALPESVAMVLWGTDNLKNEGIPIAQALALMGARPRFDGYGRLCGAELVPLAELGRPRVDV
IMTLSGIFRDLLPLQTKLLAEAAQMAAKAEEPEDMNYVRKHALAYMKTHGCDLETAALRV
FSNADGAYGSNVNQLIDSGRWQDESELAEAFTKRKSFAYGVNGKPTAQADLFNSMLADVS
LAYQNLESMELGVTTIDHYFDTLGGISKAVGRAKGGEQVPVYIGDQTKGDGKVRTLAEQV
ALETRTRVLNPKWYEGMLAHGYEGVRQIEAHVTNTMGWSATTGQVAPWVYQQLTQTFLLD
EEMRKRLAALNPTASARVANRLLEAHERKYWEPDEATLEALRRAGEELEDNLENVSEGVA
A
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
gtggcctcgcgcgcatcaccgtcgagacgctgtatgatgcaaaagcccacttcggaagct
gacgccacgccccttcgcgtggtcatcgtcaccctggacggccacctcgcgggcgccgtc
caacgcgcgcaacgcatgttgcgccaggacgtgccgggtctcaccttgcgcatgcacgcg
gcggtggaatggggcgaggatcccgaggcgctggcccgggccaaagccgacatcgcccag
gccgacatcatcctggcgacgatgttgttcctggaagaccagatcaaggccgtgctgccc
gacctccaggcccggcgcgacaagtgccatgccttggttggttgcctcgccgccggcgag
atcgttaacctgaccaagcttggcaactttaccttcgagggctcggaccggggcattttg
tccctgcttaagcgcttgaagggcgacaagaacaaggcggaaaagccgaccgccggggcc
ggggcccagcagatggccatgttgcgccgtctgccgcgcattttgcgtctgattccgggc
aaggcccaggatctgcgggcgtacttcctgaccttgcaatactggctggccggatcggat
gacaacctcatcaatatgatccgcttcctggttgatcgctatgccgccggcccccatgcc
gcctaccggggcaaggtcaaggcgcagccgccggtggactacccggacgttggcctctac
catccgcgcctgccgggccgggtgaccgatcgtctggaccgcctgccgcccctggaagcc
caggacgcggccaaggaagtgcgcggcgtggttggcgttctcgtgatgcgctcctatgtg
ctggccgggaataccgcccattacgatgccgtgatcaaggccctggaatcgcggggcctg
cgggtgattcccgcctactcgtcgggtctcgacaaccgcccggcggttgaagagtacttc
atgcgcaatggtcgggcgaccattgacctgatggtgtcgctcaccggcttctccctggtc
ggcggcccggcctacaacgacgcccgctcggccgaagagatcctggcccggctcgacgtt
ccttacatgaccacgcatgccgtcgaattccagaccctggcgcaatgggaagaatcgccg
cgtggcctgatgccggtggaatcgaccatgatggtggcgatccccgaactcgacggctgc
atcaaccccatgctctacggcgggcgcgccgacgacggcgaggccaccgaggggccgggc
cgcgagatggtggcccatcccgagcgggtcgagaccctggccgaccgcgtggcccgcatg
gtcgccctgcgccgcacgccacccgccgagcgcaaggtggcgattgtcctgttcaacttc
ccgcccaacgccggggcgaccgggaccgccgcctatctctcggtgtacgcctcgctctac
aacaccttgaaggccatggcgcgggccggctatcaggtcgaggtgccggaaagcgaggac
gccctgcgtcagcgcattttgggcggtaacgcggcccagttcggcgcgccggccaatgtc
catacccgcatccgcagcgacgaccatgtgcggcgtgaacggcatctgaacgacattgag
gcgcagtggggcccagcgcccggccgcgacctgaccgacggcgccagcttgtttgtgctg
ggcgtggagctgggcaacgtcttcatcggcatccagccgaccttcggctacgaaggcgat
cccatgcgcttgctgttcgagaagggcttttcgccgacccacgccttctcggccttctac
cgctacctgcgcgacgactacgccgcccacgccgtggttcacttcggcatgcacggtgcc
ttggagttcatgccgggcaagcaaagcggcctgtcgggcaagtgctggcccgagcgcctg
atcggcgatctgcccaacatctacctctatgcctccaacaacccgtccgagggctcgctg
gccaagcggcgctcggcggcgaccctggtcacctacctgacgccctcggtcaccgaagcc
ggtttgcacaagggcctgctggaactcaagtcctcgctggaacgctaccgcggcctgccg
ccggaagccgacgacgagcgcgaccgcatggtggccctcatccaggcccaggccgccgag
gtcaatctggccgatcccgagcctttgtggggcgacgacgcccgcacgcgcatcgagcgg
ctggtcggtcaggtgttggaggtcgaggagactctcattccccatggcctgcacgtcatc
ggtgccccgcctggccccgccgagcgtctcgacctgttgatggcggtgtgcgacgcctcg
cacggcaccaagccgccgcgcgccgccttggaggccctcatcaatggccagtctccggcc
aaggccctggccgccgggggcgtgggctccgacgccaagctgcgcgagatcttcgaagat
ctggcgcgcatgaatgccctgctggccgaggatcacgagctgccggcgttgctgcgcgct
ctcgatggccgctacatccacccggccccgggcggcgacctgctgcgcaccccggcggtg
ctgccgaccgggcgcaacatgcacggcttcgacccctggcgcctgccgtcgcgctttgcc
gtggaagatggccgccggctggccgcgatgatcctggcgcgccacacccaagacggcaac
gccttgccggaatcggtggccatggtgctgtggggtaccgacaacctgaaaaacgagggc
attcccatcgcccaggccctggccttgatgggggcgcggccgcgttttgatggctacggt
cggttgtgtggtgccgagctggtgccgctggccgagttgggccgcccgcgcgttgacgtg
atcatgaccctctcgggcatcttccgcgaccttttgccgctgcaaaccaagctgctcgcc
gaggcggcgcagatggcggccaaggccgaggagccggaggacatgaactatgtccgcaag
cacgccctggcctacatgaagacccatggctgcgacctggagacggcggcgctgcgcgtc
ttctccaacgccgacggcgcctacggctcgaacgtcaaccagctcatcgacagcgggcgc
tggcaggacgaaagcgagttggccgaggccttcaccaagcgcaagagctttgcctacggc
gtcaatggcaagccgaccgcccaggccgacctgttcaactccatgctggccgacgtcagc
ctcgcctaccagaacctggaatcgatggaactgggcgtgaccaccatcgaccactacttc
gataccctgggcggcatcagcaaggcggttggccgggccaagggcggcgagcaggtgccc
gtgtacattggcgaccagaccaagggcgacggcaaggttcgcacgctggccgaacaggtg
gctctggagacccgcactcgggtcttgaatccgaaatggtacgagggcatgctcgcccac
ggatacgagggggtgcggcagatcgaggcccacgtgacgaacaccatggggtggtcggca
acgaccggacaggtggcgccgtgggtatatcagcagttgacgcagaccttcctccttgat
gaagagatgcgcaagcgtcttgccgccctcaaccccacggcctcggcccgggtcgcgaac
cgccttctggaggctcacgagcggaagtactgggaacctgacgaagccacgctggaagcc
ttgcggcgcgccggcgaggaactggaggacaacctggaaaacgtttcggaaggagtggcg
gcatga

DBGET integrated database retrieval system