KEGG   Pararhodospirillum photometricum: RSPPHO_00057Help
Entry
RSPPHO_00057      CDS       T01851                                 

Definition
(GenBank) GGDEF domain
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
rpm  Pararhodospirillum photometricum
Brite
Enzymes [BR:rpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     RSPPHO_00057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
127675..128922
Genome map
AA seq 415 aa AA seqDB search
MRKGRGGRASPGPSSLFVSSLDHLEGISRHPWDWNRSGPFSPSSHPPDKRRRVCMAKRRK
DAMDYLETLEHADKVAQEALSCMRRLGIPSHPRNFAIWYGFFSEKFPDLSRRVQSLLENK
VVFTEAVNDDLFERFFTSRHEAEGMLVATRRLDLTLAQMRSLFLAAHQGTEAYGDALETF
GRRLLETDSGMVEVLVSAALDETRAMLDINRTLGEELTRSSAEVRQLREELERVRREALT
DGLTGLGNRKVFDAGVRDLTQRATAEATRGLSLMMLDIDHFKTFNDCYGHQMGDQVLRLV
ASMIQDSLEGEAITARYGGEEFAVLLPDTPGSEAVVVAERIRRHVASRHVTNRRTGQDLG
GITLSAGVSQYILGEAAADFIRRADEALYAAKAQGRNCVVCFEDEAGLPRRRLAP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaggccggggaggccgagcctccccgggtccctcgagcctttttgtatcgtct
cttgaccatctggaagggatttccaggcatccttgggactggaatcgctccgggccgttt
tctccctcttctcaccccccggacaaaaggcgtagggtgtgtatggctaaaaggagaaag
gatgcgatggactatctcgagacgcttgaacacgccgacaaggtggcccaggaggcgctg
tcttgtatgcgccgtctcggcatcccctctcatcctcggaattttgccatctggtatggt
tttttctcggaaaagtttcctgatttaagccggcgtgtgcagtccctcctggagaacaag
gttgtcttcaccgaagcggtgaatgatgacttgttcgagcgcttttttaccagccggcat
gaggccgagggcatgttggtcgccacgcgccgtctcgacctgaccttggctcagatgcgc
tccttgtttcttgccgcccaccagggcaccgaagcctacggcgatgccttggaaaccttt
gggcgtcgcttgctggagaccgattccggcatggtggaggtgttggtctcggcggccctg
gatgaaacccgggccatgctcgacatcaaccggaccttgggggaggagttgacccgttcg
tcggccgaggtccgccaactgcgcgaggaactggagcgggtgcgccgcgaggccctgacc
gatggtctcaccggccttggcaaccgcaaggtcttcgatgccggggtgcgcgacctgacc
cagcgcgccaccgccgaggccacgcgtggattgagcttgatgatgctcgatatcgaccac
ttcaagacatttaacgattgttatgggcaccagatgggcgatcaggtgttgcgtctggtg
gccagcatgattcaagatagcctggagggtgaggctatcacagcgcgctacggcggcgag
gagtttgccgtgttgctgcccgacactccggggagcgaggcggtggtggtggccgagcgc
attcgccgccacgtggcctcccgtcatgtcaccaatcggcgcaccggtcaggatttaggg
gggattaccctgtcggctggggtgagccagtacattctgggcgaggcggccgccgatttc
attcgccgggccgacgaggctctttatgccgccaaggcccaggggcgcaattgtgtggtg
tgctttgaggatgaggctggtctgccgcgtcggcgcttggcgccttga

DBGET integrated database retrieval system