KEGG   Rhodospirillum photometricum: RSPPHO_00057Help
Entry
RSPPHO_00057      CDS       T01851                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rpm  Rhodospirillum photometricum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
127675..128922
Genome map
AA seq 415 aa AA seqDB search
MRKGRGGRASPGPSSLFVSSLDHLEGISRHPWDWNRSGPFSPSSHPPDKRRRVCMAKRRK
DAMDYLETLEHADKVAQEALSCMRRLGIPSHPRNFAIWYGFFSEKFPDLSRRVQSLLENK
VVFTEAVNDDLFERFFTSRHEAEGMLVATRRLDLTLAQMRSLFLAAHQGTEAYGDALETF
GRRLLETDSGMVEVLVSAALDETRAMLDINRTLGEELTRSSAEVRQLREELERVRREALT
DGLTGLGNRKVFDAGVRDLTQRATAEATRGLSLMMLDIDHFKTFNDCYGHQMGDQVLRLV
ASMIQDSLEGEAITARYGGEEFAVLLPDTPGSEAVVVAERIRRHVASRHVTNRRTGQDLG
GITLSAGVSQYILGEAAADFIRRADEALYAAKAQGRNCVVCFEDEAGLPRRRLAP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaggccggggaggccgagcctccccgggtccctcgagcctttttgtatcgtct
cttgaccatctggaagggatttccaggcatccttgggactggaatcgctccgggccgttt
tctccctcttctcaccccccggacaaaaggcgtagggtgtgtatggctaaaaggagaaag
gatgcgatggactatctcgagacgcttgaacacgccgacaaggtggcccaggaggcgctg
tcttgtatgcgccgtctcggcatcccctctcatcctcggaattttgccatctggtatggt
tttttctcggaaaagtttcctgatttaagccggcgtgtgcagtccctcctggagaacaag
gttgtcttcaccgaagcggtgaatgatgacttgttcgagcgcttttttaccagccggcat
gaggccgagggcatgttggtcgccacgcgccgtctcgacctgaccttggctcagatgcgc
tccttgtttcttgccgcccaccagggcaccgaagcctacggcgatgccttggaaaccttt
gggcgtcgcttgctggagaccgattccggcatggtggaggtgttggtctcggcggccctg
gatgaaacccgggccatgctcgacatcaaccggaccttgggggaggagttgacccgttcg
tcggccgaggtccgccaactgcgcgaggaactggagcgggtgcgccgcgaggccctgacc
gatggtctcaccggccttggcaaccgcaaggtcttcgatgccggggtgcgcgacctgacc
cagcgcgccaccgccgaggccacgcgtggattgagcttgatgatgctcgatatcgaccac
ttcaagacatttaacgattgttatgggcaccagatgggcgatcaggtgttgcgtctggtg
gccagcatgattcaagatagcctggagggtgaggctatcacagcgcgctacggcggcgag
gagtttgccgtgttgctgcccgacactccggggagcgaggcggtggtggtggccgagcgc
attcgccgccacgtggcctcccgtcatgtcaccaatcggcgcaccggtcaggatttaggg
gggattaccctgtcggctggggtgagccagtacattctgggcgaggcggccgccgatttc
attcgccgggccgacgaggctctttatgccgccaaggcccaggggcgcaattgtgtggtg
tgctttgaggatgaggctggtctgccgcgtcggcgcttggcgccttga

DBGET integrated database retrieval system