KEGG   Rhodospirillum photometricum: RSPPHO_00240Help
Entry
RSPPHO_00240      CDS       T01851                                 

Definition
Cytochrome c2
Orthology
K08738  
cytochrome c
Organism
rpm  Rhodospirillum photometricum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RSPPHO_00240
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSPPHO_00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(330256..330666)
Genome map
AA seq 136 aa AA seqDB search
MNKGILAAGVVIAMALANGTAFAAGDAAAGEKIAKAKCTACHDLNKGGPIKVGPPLFGVF
GRTTGTFAGYSYSPGYVTMGQKGHAWDDAALKSYLLDPKGYVQAKSGDPKANSKMIFRLE
KDEDAANVIAYLHTLK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaggtattctggccgctggcgtcgtgatcgccatggccctggccaatggcacg
gccttcgctgctggcgacgccgccgccggcgagaaaatcgctaaagccaagtgcacggct
tgccacgacctgaacaaggggggcccgattaaggtcggcccgccgctgtttggcgtgttc
ggccgcaccaccggcacgttcgccgggtattcctattccccgggctatgtgaccatgggg
cagaagggtcatgcctgggatgatgccgctctgaagtcctacctgctggatccgaagggc
tacgttcaggcgaagtccggcgatcccaaggccaactccaagatgatcttccgtctggag
aaggacgaagacgctgccaatgtcatcgcctatcttcataccctgaagtaa

DBGET integrated database retrieval system