KEGG   Rhodospirillum photometricum: RSPPHO_00240Help
Entry
RSPPHO_00240      CDS       T01851                                 

Definition
Cytochrome c2
Orthology
K08738  
cytochrome c
Organism
rpm  Rhodospirillum photometricum
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rpm00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpm02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(330256..330666)
Genome map
AA seq 136 aa AA seqDB search
MNKGILAAGVVIAMALANGTAFAAGDAAAGEKIAKAKCTACHDLNKGGPIKVGPPLFGVF
GRTTGTFAGYSYSPGYVTMGQKGHAWDDAALKSYLLDPKGYVQAKSGDPKANSKMIFRLE
KDEDAANVIAYLHTLK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaggtattctggccgctggcgtcgtgatcgccatggccctggccaatggcacg
gccttcgctgctggcgacgccgccgccggcgagaaaatcgctaaagccaagtgcacggct
tgccacgacctgaacaaggggggcccgattaaggtcggcccgccgctgtttggcgtgttc
ggccgcaccaccggcacgttcgccgggtattcctattccccgggctatgtgaccatgggg
cagaagggtcatgcctgggatgatgccgctctgaagtcctacctgctggatccgaagggc
tacgttcaggcgaagtccggcgatcccaaggccaactccaagatgatcttccgtctggag
aaggacgaagacgctgccaatgtcatcgcctatcttcataccctgaagtaa

DBGET integrated database retrieval system