KEGG   Pararhodospirillum photometricum: RSPPHO_00520Help
Entry
RSPPHO_00520      CDS       T01851                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00340  Histidine metabolism
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
rpm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    RSPPHO_00520 (hisD)
Enzymes [BR:rpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RSPPHO_00520 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CCG07146
UniProt: H6SP74
Position
673132..674436
Genome map
AA seq 434 aa AA seqDB search
MPVRLDARDPGFEAAFTTLLGGKRESAQDVNDTVAAILDDVRRRGDAAVLEYTARFDRLT
LEPQGLRVSLGEIDTAVATVDPDVRDALALAADRIASFHGRQVPQGFSYTDQAGVRLGQR
WTPVSAVGLYVPGGTAAYPSSVLMNAVPAKVAGVERVVMVVPTPGGVLNPLVLVAARMAG
VDEIYRIGGAQAVGALAYGTATIAPVDKIVGPGNAYVAAAKRQVFGTVGIDMIAGPSEIL
VVADASNDPDWIAMDLLSQAEHDAAAQSILITDDEAFADAVERAVAIQLASLSRVDIASA
SWRDHGAVIVVGDLLADAPALVDRVAPEHLELAVTDPDALAERVKHAGAIFLGRHTPEAI
GDYVAGPNHVLPTSRTARFSSGLGVLDFMKRTTLVGCSPGALGALGRAAVRLAQAEGLEA
HGLSVATRLNIPRF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgcggcttgacgcgagagatcccgggtttgaggcggcgttcacgaccttgctg
ggcggcaagcgtgagtcggcgcaagacgtcaacgacaccgtggccgcgatcctcgacgac
gtgcgccgtcgaggcgatgcggccgttttggagtataccgcgcgctttgaccgcctgacc
ctggagccccagggattgcgggtcagccttggcgagatcgacacggccgtggccaccgtt
gatcccgacgtgcgcgacgccctggccctggccgccgatcgcattgcctcgtttcatggc
cgtcaggtgccgcagggctttagctacaccgatcaggctggggtgcgcctgggccagcgc
tggacgccggtctcggcggtcggcctgtatgtgccgggcggcacggcggcctatccctcg
tcggtgctcatgaacgccgtgcccgccaaggtggccggcgtcgagcgcgtggtcatggtg
gtgcccacccccggcggcgtgctcaacccgctggtgctggtggcggcgcgcatggccggg
gtcgatgagatctaccggattgggggggcccaggccgtgggcgccctggcctacggcacc
gcgaccatcgctcccgtcgataagatcgtggggccgggcaatgcctatgtggcggccgcc
aagcgccaagtgtttggcacggtgggcatcgacatgatcgccggtccctcggaaattttg
gtggtggccgatgccagcaacgatcccgactggattgccatggatctgttgtcccaggcc
gagcacgacgccgccgcccagtcgatcctgatcaccgacgacgaggctttcgccgatgcg
gtggagcgggccgtcgcgatccagttggcctcgttgtcgcgcgtggacattgcctcggcg
tcgtggcgcgatcacggggcggtcatcgtggtgggggacctgctggctgacgcgccggcc
ctggtcgatcgcgtggcgcccgagcacctggaactcgccgtcaccgatcccgatgccctg
gccgagcgtgtgaagcatgccggggccatcttcctggggcgccataccccggaggccatc
ggcgattatgtggccggacccaaccacgtgctgccgacctcgcgtaccgcgcgcttctcc
tcgggattgggggtgcttgacttcatgaagcggaccacgttggtcgggtgttcccccggc
gctctgggggccctgggcagggccgccgtgcgtctggcccaggcggagggattggaagcc
cacggcttgtcggtggcgacccgcctgaacatccctcggttctag

DBGET integrated database retrieval system