KEGG   Rhodospirillum photometricum: RSPPHO_00601Help
Entry
RSPPHO_00601      CDS       T01851                                 

Definition
Carbohydrate kinase, FGGY (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rpm  Rhodospirillum photometricum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RSPPHO_00601
Enzymes [BR:rpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RSPPHO_00601
Exosome [BR:rpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSPPHO_00601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769893..770525
Genome map
AA seq 210 aa AA seqDB search
MRPMPPTRRAPCCSTSTTSAGTPDLLELFGVPLAMMPEVRDSAALFGHTDPEIYGRPVPI
GGIAGDQHAALIGQGCVNRGMVKSTYGTGCFMLANTGPKPLPSHHRLLTTLAYRLQGEPT
YALEGSIFNAGTSVQWLRDELGVIGQAATSEVLARGLKNNRGVYFVPAFTGLGRPLLGPA
GAGRDFWVGTRYRRGRTGPRRPGERVLPVG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccgatgccaccaacgcgtcgcgcaccatgctgttcaacatccacaaccagcgct
gggacccccgaccttctggagttgtttggggtgccgctggccatgatgcccgaggtccga
gacagcgccgcgctgtttggccacaccgatcccgagatctatggccggcccgtgcccatc
ggcgggatcgccggcgaccagcacgcggcgctgatcggccagggctgtgtcaaccggggc
atggtcaagagcacctatggcacgggctgcttcatgctagccaacacgggccccaagccc
ctgccctcccaccatcgcctgctcaccaccttggcctatcgcctccagggcgaaccgacc
tacgccctggagggctcgattttcaacgccggaacctcggtgcagtggctgcgtgacgag
ttgggggtgatcggacaggccgcgaccagcgaggtcctggcccggggtctcaaaaacaat
cggggcgtgtattttgtgcccgccttcaccggcttgggccgccccctactgggacccgct
ggcgcggggcgcgatttttgggttggcacgcgataccggcgtggccgaactggtccgcgc
cgccctggagagcgtgtgttaccagtcggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system