KEGG   Pararhodospirillum photometricum: RSPPHO_00622Help
Entry
RSPPHO_00622      CDS       T01851                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00010  Glycolysis / Gluconeogenesis
rpm00051  Fructose and mannose metabolism
rpm00562  Inositol phosphate metabolism
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
rpm01120  Microbial metabolism in diverse environments
rpm01130  Biosynthesis of antibiotics
rpm01200  Carbon metabolism
rpm01230  Biosynthesis of amino acids
Module
rpm_M00002  Glycolysis, core module involving three-carbon compounds
rpm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPPHO_00622
   00051 Fructose and mannose metabolism
    RSPPHO_00622
   00562 Inositol phosphate metabolism
    RSPPHO_00622
Enzymes [BR:rpm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RSPPHO_00622
Exosome [BR:rpm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RSPPHO_00622
  Exosomal proteins of bladder cancer cells
   RSPPHO_00622
  Exosomal proteins of melanoma cells
   RSPPHO_00622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID: CCG07248
UniProt: H6SPX8
Position
complement(789160..789942)
Genome map
AA seq 260 aa AA seqDB search
MSMIARRPLIAGNWKMNGLKAEARALAEAMAARFNSVGSVGFDMLLCPPFPVIGTVVGAV
AGTGIAVGGQDCHAKVSGAHTGDVSAAMLADQGCQFVIVGHSERRADHGESDAQVRAKAE
AALAAGLVAVICVGETEAQRDAGQTLRVVETQLEGSLPAGATAQTVVIAYEPVWAIGTGR
TPTLNDVAQVHGAIRAKVARVLSAEAAAEMRVLYGGSVKPDNARALLGLADVDGALVGGA
SLKAEDFWAIGCATPGPDAD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttgtccatgatcgcacgtcgcccgctgatcgccggaaactggaagatgaacggcctgaag
gccgaggcccgcgccctggccgaggcgatggcggcgcgcttcaacagcgtggggtcggtg
ggctttgacatgctgttgtgcccgccctttccggtgattggcacggtggtgggggcggtg
gccggcaccgggatcgcggtcggggggcaggactgccatgccaaggtgtcaggcgcccat
accggcgacgtctcggccgctatgctggccgaccagggctgtcagttcgtgattgtcggc
cactcggagcggcgcgccgatcatggcgagagcgatgcccaggtgcgcgccaaggccgag
gccgccctggccgccgggttggtcgccgtgatctgtgtcggcgagaccgaggcccagcgc
gatgccggccagaccctgcgggtggtcgagacccagttggaaggctcgctaccggccggc
gctacggcgcagactgtggtcatcgcctatgagcccgtctgggccatcggcaccgggcgc
acgccgactctcaacgacgtggcccaggtgcatggggcgatccgggccaaggtggcgcgg
gtgctgtcggccgaggcggcggccgagatgcgggtgctttatggggggtcggtcaaaccc
gacaacgcccgcgccctgctgggcttggccgatgtcgatggcgcgttggtcggcggcgcc
agcctcaaggccgaagatttttgggccatcggctgcgccactcccggcccggacgccgac
tga

DBGET integrated database retrieval system