KEGG   Rhodospirillum photometricum: RSPPHO_00622Help
Entry
RSPPHO_00622      CDS       T01851                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpm  Rhodospirillum photometricum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSPPHO_00622
   01230 Biosynthesis of amino acids
    RSPPHO_00622
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPPHO_00622
   00051 Fructose and mannose metabolism
    RSPPHO_00622
   00562 Inositol phosphate metabolism
    RSPPHO_00622
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RSPPHO_00622
Enzymes [BR:rpm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RSPPHO_00622
Exosome [BR:rpm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RSPPHO_00622
  Exosomal proteins of bladder cancer cells
   RSPPHO_00622
  Exosomal proteins of melanoma cells
   RSPPHO_00622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(789160..789942)
Genome map
AA seq 260 aa AA seqDB search
MSMIARRPLIAGNWKMNGLKAEARALAEAMAARFNSVGSVGFDMLLCPPFPVIGTVVGAV
AGTGIAVGGQDCHAKVSGAHTGDVSAAMLADQGCQFVIVGHSERRADHGESDAQVRAKAE
AALAAGLVAVICVGETEAQRDAGQTLRVVETQLEGSLPAGATAQTVVIAYEPVWAIGTGR
TPTLNDVAQVHGAIRAKVARVLSAEAAAEMRVLYGGSVKPDNARALLGLADVDGALVGGA
SLKAEDFWAIGCATPGPDAD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttgtccatgatcgcacgtcgcccgctgatcgccggaaactggaagatgaacggcctgaag
gccgaggcccgcgccctggccgaggcgatggcggcgcgcttcaacagcgtggggtcggtg
ggctttgacatgctgttgtgcccgccctttccggtgattggcacggtggtgggggcggtg
gccggcaccgggatcgcggtcggggggcaggactgccatgccaaggtgtcaggcgcccat
accggcgacgtctcggccgctatgctggccgaccagggctgtcagttcgtgattgtcggc
cactcggagcggcgcgccgatcatggcgagagcgatgcccaggtgcgcgccaaggccgag
gccgccctggccgccgggttggtcgccgtgatctgtgtcggcgagaccgaggcccagcgc
gatgccggccagaccctgcgggtggtcgagacccagttggaaggctcgctaccggccggc
gctacggcgcagactgtggtcatcgcctatgagcccgtctgggccatcggcaccgggcgc
acgccgactctcaacgacgtggcccaggtgcatggggcgatccgggccaaggtggcgcgg
gtgctgtcggccgaggcggcggccgagatgcgggtgctttatggggggtcggtcaaaccc
gacaacgcccgcgccctgctgggcttggccgatgtcgatggcgcgttggtcggcggcgcc
agcctcaaggccgaagatttttgggccatcggctgcgccactcccggcccggacgccgac
tga

DBGET integrated database retrieval system