KEGG   Rhodospirillum photometricum: RSPPHO_00673Help
Entry
RSPPHO_00673      CDS       T01851                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rpm  Rhodospirillum photometricum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rpm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
852767..854959
Genome map
AA seq 730 aa AA seqDB search
MVMSDDASGALRRLAARAGVIDTYHDAFGQHMVTSDAALMAALTALGWPLTAVEDAPRVL
HDWDLARPVPLLPPVIVHRVGRGPVVVPLGWPETAGPGHWSILWEASLALPATEGFFDPA
TLPWMAAGPDHDGCRRLELSLPSTPWGYHRLRVQGLGVPAQDIPLILTPERCWLPEGTED
PETPTRLWGLTCQVHGLRGRRDWGMGDFGTLAALARQVGREGGDVLGINPVHALFPTRPL
HASPYSPNSRLFLNPLYICIDDIPEAAGCPEIARLAADLEEVRAPDLVDHEAVAARKGPA
LEAAHARFVATEQGRSTPRAQAYAQFVAAGGVILERFAVFLTLGDLYAERGCSWRDWPAE
VHDPESPAVAQIALEHRQRVDFHLWCQFEADRQLGRVAEVAAQSGQRLGLYRDLALGSDP
TGADSWMLGDMLVNGLAVGAPPDPWNAAGQNWGFSPFHPERLRRAGYEPFARMIRATMRH
AGALRIDHVLGQLRLFCIPRGMAGRDGLYLRMPFDDLLAVLALESHRARCLVVGEDLGTV
PDGFRDRMHEAAILSCRLFYFERQDHRALIAPEAYPRLAAVSASTHDLPTLHGFWSGTDL
AWKNTLGLFPSPAIRDMESMERHNDRPLIRETLAQAGQPLDPSEGFTPPANLVPAVTAWL
ARTPSLLVTVQIEDVLEEREQANLPGTLDEHPNWRRRVGVAVEDLEADGRLDRIARLFAA
SRRGTVEWPG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgtctgacgacgcctcgggcgccttgcgccgtctggccgcgcgggccggagtg
atcgacacctatcatgacgccttcggccagcacatggtcacgtccgacgcggcgctgatg
gcggcactcaccgcgttgggctggcccctgaccgcggtggaggacgccccgcgcgtgctg
catgactgggacctcgcgcgccctgtccccttgttgccaccggtcatcgtccaccgggtg
ggtcggggaccggtggtggtaccgttgggctggccggagacggcgggtcccgggcactgg
agtatcttgtgggaggcgagccttgccctgccggccacggaggggttcttcgatccggcg
accctgccctggatggcggcgggaccggatcacgacggctgccggcggctggagctctcc
ttgccttcgacgccttggggctaccaccgcttgcgggtgcagggcctgggagtgccggcg
caggacatccccttgattctgacgcccgaacggtgctggctgcccgaggggaccgaagac
cctgaaacccccacccggctctggggactgacctgccaagtgcacggcctgcgcggtcgg
cgcgactggggcatgggagatttcggcaccctggcggcgctggcccggcaggtggggcgc
gagggcggtgacgtgctgggaatcaacccggtgcacgccttgttcccaacccgaccgctg
cacgcgagcccgtattcgcccaattcccgcctgtttctcaacccgttgtacatttgtatc
gatgacattcccgaggcggcgggctgcccggaaatcgcccgtctggccgccgacttggaa
gaggtgcgcgcgcccgatctggtggaccacgaagccgtcgcggcccgcaaggggcccgcg
ctggaagcggcccacgcccgctttgttgcgaccgagcagggccgctcaaccccccgggcc
caggcctatgcccagttcgtggccgcggggggcgtgattctggaacgctttgccgtgttc
ttgaccctgggcgacctgtatgccgagcggggctgttcgtggcgggactggccggccgag
gtgcacgatcccgaaagcccggccgtcgcccagatcgccttggagcatcggcagcgggtg
gatttccatttgtggtgccagttcgaggcggaccggcagttgggacgggtggccgaagtg
gcggcccaatcgggacaacgccttggcctgtatcgcgatctagccttgggctcggacccc
acgggcgcggatagctggatgctgggcgacatgctggtgaacgggctggccgtgggggcg
ccccccgatccgtggaacgcggcgggccagaactggggcttttcgccgtttcatcccgag
cggctgcgccgggctggctacgagcctttcgcccgcatgatccgggccaccatgcgccac
gcgggcgccttgcgcatcgaccatgtgctggggcagttgcggctgttttgcatcccgcgc
ggcatggccggacgcgacggcctctacctgcggatgccctttgacgatttgctggcggtg
ctggccctggagagccatcgggcgcggtgcttggtggtgggcgaggacctgggcacggtg
cccgatggctttcgcgaccgcatgcatgaagcggccatcttgtcatgccgtttgttctat
ttcgagcgccaggaccaccgggcgctcattgccccggaggcctatccccggctggcggcg
gtgtcggcctcgacccacgacctgccgaccctgcacgggttctggtcgggaacggatctg
gcgtggaaaaacaccctgggcctgtttccgtcgcccgccatccgggacatggagagcatg
gagcggcacaacgaccgtcccttgatccgcgagaccctggcgcaggccggacagccgctg
gacccgtccgaggggttcacaccgccggccaatctggtgcctgcggtcacggcttggctg
gctcgcacgcccagcttgctggtgacggttcagattgaggacgttttggaagaacgcgag
caggcgaaccttccgggcaccttggacgagcaccccaactggcgccgccgggttggggtg
gccgtcgaagacctggaggcggacggccgcttggaccggatcgcacgcctgttcgccgca
tcgcgacgcggcaccgtggagtggcctggatga

DBGET integrated database retrieval system