KEGG   Rhodospirillum photometricum: RSPPHO_00738Help
Entry
RSPPHO_00738      CDS       T01851                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rpm  Rhodospirillum photometricum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSPPHO_00738
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSPPHO_00738
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RSPPHO_00738
Enzymes [BR:rpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RSPPHO_00738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916306..917712
Genome map
AA seq 468 aa AA seqDB search
MRYVSTRGRAPVLTFDDVLLAGLAEDGGLYVPSHWPTFTPDDIRDMRGLSYQELAVQVMG
PFVAGALTDDELTQVVEDAYASFTHPAIAPLRQLGPDDWVMELFHGPTLAFKDYALQVVG
GLFDLILARRGERVTVVGATSGDTGSAAIAALRDRAAVDVVILLPKGRVSEVQRRQMTTV
ESPNVHVVAVDGTFDDCQALVKSLFADVAFRDEVGLGAVNSINWARVMAQTVYYFWAALR
LGAPDRTLGFAVPTGNFGNVLAGWVARQMGLPIERLVVGSNRNDILARFLETGTMSRRPV
EQSYSPSMDIQVSSNFERLLFEIVDRDAPEVERMLRQFAATGSYKVAEPLHQELLGLFRG
YRLDDPGTEQAIADLYAATGEILDPHSAIGVMAGRVAGHRDLGTPMVALATAHPAKFPEV
VERATGVRPALPPRLADLMTRPERLTDLPNDVEAVKALVRQRIAGGRA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgagatacgtgagcacccggggccgcgcccccgtcttgacctttgatgacgttctgctg
gctgggctcgccgaggacggtggcctgtacgtgcccagccattggccgaccttcaccccc
gacgacatccgggacatgcgtggcctgtcctatcaggagctggcggtccaggtgatgggg
ccgtttgtggccggggcgctgaccgacgacgaactgactcaggtcgtcgaggacgcctat
gccagctttacccacccggccattgcccccttgcgccaactggggcccgatgattgggtc
atggagttgttccatgggccgactctggcgtttaaggactacgccttgcaggtcgtgggc
ggcctgttcgacctgatcttggcgcgccggggcgagcgcgtcacggtggtgggcgccacc
agtggcgacaccggcagcgccgccattgccgccctgcgcgaccgcgcggccgtcgatgtg
gtgatcttgctgcccaagggccgggtctccgaggtgcagcgccggcagatgaccacggtc
gagagccccaacgtccatgtcgtggcggtggacggcacctttgacgactgtcaggccctg
gtgaagtccttgtttgccgatgtcgccttccgtgacgaggttggcctgggggcggtgaat
tccatcaactgggctcgggtgatggcccagactgtctactatttctgggcggccctgcgc
ctgggcgcccccgaccggaccttgggctttgccgtgcccaccggtaactttggcaacgtg
ctcgccggctgggtggcgcggcagatggggctgcccatcgagcgtctggtggttggctcc
aaccgcaacgacatcctggcccgcttcctggaaaccgggaccatgagccgccgcccggtg
gagcagagctatagtccctcgatggacatccaggtctccagcaacttcgagcgcctgttg
ttcgagatcgtggaccgtgacgctcccgaggtcgagcgcatgctgcgccagttcgccgcc
accggcagctacaaggtggccgagcccctgcatcaggagctgctgggtctgttccggggc
tatcgcctcgacgatcccggcaccgagcaggccatcgccgatctctatgccgcgaccggc
gagatcctcgacccccacagtgccatcggcgtgatggccgggcgggtggccgggcatcgg
gacctgggcacccccatggtggcgctggccaccgcccatcccgccaagttccccgaggtt
gtcgagcgcgcgaccggggtgcgcccggccctgccgcccagactcgccgacctgatgacc
cgtcccgaacggctcaccgacctgcccaatgatgtcgaggccgtgaaggccttggtgcgc
cagcggatcgccggaggccgggcatga

DBGET integrated database retrieval system