KEGG   Rhodospirillum photometricum: RSPPHO_00814Help
Entry
RSPPHO_00814      CDS       T01851                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rpm  Rhodospirillum photometricum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rpm00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rpm00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rpm00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rpm00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1022737..1023732
Genome map
AA seq 331 aa AA seqDB search
MACQTLLEVRRPPWHERWRTAAGSKRAPGRCRPIKPRGKRMSRRVRKAVFPVAGMGTRFL
PATKTMPKEMLPVVDKPLIQYAVEEAAAAGIDHFIFITGRGKGPLLDHFDHMPELEALLK
ERGNITVLDTLLGAKPPPGKVYSTRQQQPLGLGHAVWCAKAFVGDEPFAVLLPDDLVLSD
QPCIKQLLDVHEKMGGNVVAVEEVPRERTNKYGILDVVEDNGVVARAKGLVEKPAPNVAP
STMAIIGRYVLEPGIFEHLEKVQRGAGGEIQLTDAMNAMIDSTPFHGLRYEGKRFDCGDK
VGFLQANIAFALDRPDMRDAVREMLGEFTAE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttggcctgtcaaaccctgcttgaagtccgccggccgccatggcatgaacgctggaggacg
gccgccgggagcaagcgcgcccccggacgatgccgccccatcaaaccaagagggaaacgc
atgtctcgacgtgtccgtaaggccgtatttccggtggcggggatgggcacacggttcttg
ccggcgaccaagaccatgcccaaggaaatgctgcccgtcgtcgacaagcctctgattcag
tatgcggtcgaggaagccgccgccgctggcatcgaccatttcatctttatcaccggccgg
ggcaagggcccgctgctcgaccacttcgaccatatgccggagctcgaagccctgctgaag
gagcgcggcaacatcaccgtgctcgatacgcttctgggggccaagccgccgcccggcaag
gtctattccacccgccagcagcagcccctgggcctggggcacgccgtgtggtgtgccaaa
gcgttcgtgggcgacgagccctttgccgtgttgctgcccgacgatttggtattgtcggac
caaccttgtatcaagcagctccttgacgttcacgagaagatgggcggcaacgtcgtcgcg
gtggaagaggtgccgcgcgagcgtaccaacaagtacggtatcttggatgttgtcgaggac
aacggcgttgtggcccgcgccaagggcttggtggaaaagcccgcccccaatgtcgcgccc
tcgaccatggccatcatcggtcgctatgtcctggagcccggcatcttcgagcatctggaa
aaggtccagcgcggcgccggcggcgagatccagctcaccgacgccatgaacgccatgatc
gactccacccccttccatggcctgcgctatgagggcaagcggttcgattgcggcgataag
gtcggcttcctccaggccaacatcgccttcgccctcgaccggcccgacatgcgcgacgcc
gtgcgcgaaatgctgggcgagtttaccgccgaataa

DBGET integrated database retrieval system