KEGG   Rhodospirillum photometricum: RSPPHO_00983Help
Entry
RSPPHO_00983      CDS       T01851                                 

Gene name
cheB5
Definition
Chemotaxis response regulator protein-glutamate methylesterase 5 (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rpm  Rhodospirillum photometricum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpm02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rpm02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1223900..1224955
Genome map
AA seq 351 aa AA seqDB search
MDKRIRVLLVDDSALARGLLRVVLENEPDFDIVGEARHGREAVDLARTLRPDLITMDLEM
PVMGGLEAIETIMTSRAVPILVVSNEADAQNAYAAVARGALEVVPKPILGSPEQDDFVAK
ARLVAGVPVITHVRSLRLGTPPLPLPDSSSVTQGGALDALPGPPPAFVIASSTGGPQALA
RILSQLPPQFPCPVLIAQHIADGFAAGMADWLATISSVPVGLGGEGQRIQAGRVVIAPTE
CHLAVTPGRRLTLRPRGAQDVYRPSCDVLLESAATVFGRQCVGIILTGMGSDGARGLAAV
RRAGGRTLAQNEATSVIFGMNRVAIEQGSVERVLPLDAIPAAMLQLAETLA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacggatccgcgtccttctcgtggacgacagtgccctcgcccgcggactgttg
cgggtggtgctagagaacgaacccgattttgatattgtcggcgaggcgcgccacggccgc
gaggcggtggatctggcgcggaccttgcgtcccgacctgatcactatggacctggagatg
ccggtgatgggggggctggaggccattgagaccatcatgaccagccgcgccgtgccgatc
ttggtggtcagcaacgaagccgatgcccaaaacgcctatgcggccgtggcccggggtgcc
ctggaggtggtccccaaacccatcttgggctccccggagcaggacgatttcgtggctaag
gcgcggttggtggccggtgtcccggtgatcacccatgttcgctccttgcgcctgggaacg
ccccccctgcccttgcccgactcgtcctccgtcacgcaagggggggctttggacgccttg
ccaggaccgcccccggcgtttgtcattgcctcgtccacgggagggccgcaagccctagcg
cggatcttgtcccagttgccgccgcagtttccctgcccggtgctgattgctcaacatatc
gccgatggctttgccgccggcatggccgactggctggcgaccatctccagcgtgccggta
ggattgggcggcgaggggcagcggatccaggcggggcgggtggtgatcgcccccaccgaa
tgccatcttgccgtgactccgggacggcgcctgaccttgcggccgcgcggcgcccaggat
gtctatcgcccgtcttgcgatgtcttgttggagagcgcggcgaccgtgtttggccgccag
tgcgtgggcattatcctcacgggcatgggcagtgacggggcacggggactggcggcggtg
cgccgggctggcggccgtaccttggcccagaacgaagcgacctcggtgatctttggcatg
aacagggtggccattgagcaaggctcggtggagcgggtcctaccgctcgacgccatcccc
gccgccatgcttcagttggcggagaccctggcatga

DBGET integrated database retrieval system