KEGG   Rhodospirillum photometricum: RSPPHO_00992Help
Entry
RSPPHO_00992      CDS       T01851                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rpm  Rhodospirillum photometricum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rpm00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rpm00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1233436..1234338)
Genome map
AA seq 300 aa AA seqDB search
MPPKGPVPSSNRPGRLLWSCGTKNRKSAGDPTPRRALMSGSQTRHVALITGSTSGIGLGI
ARALAASGRDIMLSGFGEAAAIDALRHEIETEHGVRCLYRFADLADPLACRALVAETESR
LGRLDILVNNAGIQHVDSVPDFPIEKWDHVIAVNLSAVFHCSAAALPGMIARDFGRIVNI
ASAHGLVASVNKSAYVAAKHGVVGLTKVMALENAQRPLTVNAVCPGWVLTPLVQRQIEAR
AEAGGLSVEAATAQLLGEKQPAGRFVTPEQLGAFVVFLCSEAAATLTGAALPVDGGWTAQ
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgcccccaaagggcccggtcccttcttccaatcgccctgggcgattgctgtggtcttgt
ggtaccaaaaaccgtaaaagcgcgggagaccctactccaaggagagcgttgatgagcgga
tcccagacccgacacgttgccctgatcaccggatcgaccagtggtatcggccttggcatc
gcccgggcgctggccgcctccgggcgcgatatcatgttaagcggctttggcgaggctgcc
gccatcgacgccttgcgccacgagatcgaaaccgagcacggtgtgcgctgcctgtatcgc
tttgctgacctcgccgatcccctggcttgccgggccctggtggccgaaaccgaatcccgc
ctcgggaggctcgacatcttggttaacaatgctgggatccagcatgtggacagcgtgccc
gactttcccatcgagaaatgggaccacgtgatcgccgtcaacctgtcggcggtgttccac
tgctcggcggcggcgctgcctggcatgatcgctcgggatttcggacgcatcgtcaacatc
gccagcgcccacggcctagtggccagtgtcaacaagtcggcgtatgtcgccgccaagcac
ggggtggtggggctcaccaaggttatggccctggaaaatgcccagcgacccctgaccgtg
aatgccgtgtgcccgggctgggtactgacgcctctggtccagcggcaaatcgaggcgcgg
gcggaggctggggggctatcggtcgaggcagccacggcccagctcttgggggaaaagcag
ccggccggccgctttgtgaccccggagcaattgggggcctttgttgttttcctgtgctcc
gaggcggccgcaaccctgaccggcgccgccttgcccgtggacggcgggtggaccgctcag
taa

DBGET integrated database retrieval system