KEGG   Rhodospirillum photometricum: RSPPHO_01001Help
Entry
RSPPHO_01001      CDS       T01851                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rpm  Rhodospirillum photometricum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSPPHO_01001
   01230 Biosynthesis of amino acids
    RSPPHO_01001
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPPHO_01001
   00030 Pentose phosphate pathway
    RSPPHO_01001
   00051 Fructose and mannose metabolism
    RSPPHO_01001
   00052 Galactose metabolism
    RSPPHO_01001
  Energy metabolism
   00680 Methane metabolism
    RSPPHO_01001
Enzymes [BR:rpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RSPPHO_01001
Protein phosphatases and associated proteins [BR:rpm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RSPPHO_01001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1241767..1242864
Genome map
AA seq 365 aa AA seqDB search
MSDIRRIGVLTSGGDCAGLNAVIRAVTHRAVGTYGWKVLGILDGTLGLMDRPLRYTELDL
DGFAGHDILRAGGTVLGTINKGDPFNFPMPDGGFMDRSLDFVDGFHRLELDGLIVIGGDG
SMRILKKLCDKGSIGMVGVPKTIDNDVEGTEYAVGFSTAVNVVTEALDRLQATAASHHRV
MILEVMGRDAGHIAMNAGIAGGADVILVPEMPYTLDGITQRIRTVQAEGRSHALIVVAEG
VKTLDGQSAMQRHTGGEMRYGGIGAYLSDHIEQATNIETRVTILGHVQRGGIPSMRDRLL
ASVFGVHAVDLLAQRRFGRMVAWQNRGAIDLPLEDVCIGPRCLDPKGPLVHTAHGLGIYV
GEAGC
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatccgacgcatcggcgtcctcaccagcggtggggattgcgccggtctcaac
gccgtgatccgggcggtgacccatcgcgcggtcggtacctatggctggaaggtgctgggt
attctcgatggcaccttgggcctcatggaccggcccttgcgctacaccgaactcgatctc
gacggttttgccggtcacgatatcctgcgcgctggcgggacggtgctgggtaccatcaac
aagggcgatcccttcaacttccccatgcccgatggcggtttcatggaccgctccttggat
ttcgtcgatgggttccatcggctggaacttgatggcctgatcgtgatcggcggcgacggc
tccatgcgcatcttgaaaaagctctgcgacaagggatccatcggcatggtgggcgttccc
aagaccatcgacaacgacgttgaggggaccgagtatgccgtgggcttctcgacggccgtc
aacgtagtgaccgaggctctggaccgccttcaggccacggcggccagccatcaccgcgtg
atgatcttggaggtcatgggccgcgacgccggccacattgccatgaacgccgggatcgcc
ggaggagccgacgtcatcttggtgcccgagatgccctacaccctggacggcatcacccag
cgcatccgcacggtccaggccgaaggccgcagccacgccctgattgtggtggccgagggc
gtcaagaccctggacggccaaagcgccatgcagcgccacaccggcggcgagatgcgctat
ggtggcatcggcgcctatctttcggaccatatcgagcaggccacaaacatcgaaacccgc
gtcaccatcttgggccatgtccagcgcggcggcatcccctccatgcgcgaccgccttctg
gcctcggtgttcggcgtccacgccgtggacctcctggcccagcgccgctttggccggatg
gttgcttggcaaaaccggggcgccatcgacctgcccttggaggatgtgtgcattggcccg
cgctgccttgaccctaagggccccctggttcacacggcccacggccttggcatttacgtg
ggcgaggctggctgctag

DBGET integrated database retrieval system