KEGG   Rhodospirillum photometricum: RSPPHO_01006Help
Entry
RSPPHO_01006      CDS       T01851                                 

Definition
7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rpm  Rhodospirillum photometricum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSPPHO_01006
Enzymes [BR:rpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RSPPHO_01006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1246811..1247371
Genome map
AA seq 186 aa AA seqDB search
MRASVPYYLSGNLSFPGSQARDWTKPMILIALGSNLPSPAGPPRETLVQALAALDEAGVR
VEICSEFYLTAPVPPSGQPDYVNAVARVATDRPPEALLTLLHAIEARFDRERTALNAART
LDLDLLDYHGRCQEGPPCLPHPRLAERAFVLVPLADIAPTWIHPHLQRDVHQLLAALPPG
QDIRPA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgtctgttccctactatctcagtggtaatcttagtttcccgggttcgcaagca
cgcgattggacgaagccaatgattctcattgctctggggagcaatcttcccagcccggca
ggaccaccgcgcgagaccctggtccaagcgttggccgctttggatgaagccggggtgagg
gttgagatctgctcggagttttacctgaccgctcctgtaccgccctcaggacagcccgat
tatgtcaacgccgtggcccgagtggccaccgatcgaccaccggaggccttgttgaccctc
cttcatgcgattgaggcccgcttcgatcgcgagcgcacggccctcaacgccgcccggacc
ttggacctcgaccttctcgattaccatggacggtgccaggagggaccgccgtgcctgccc
cacccccggcttgccgagcgcgcgtttgtgctggttcccctggccgacattgcccccacg
tggatccacccccacttgcagcgcgacgtacaccagcttcttgccgcgctgcccccgggc
caagacatccgcccggcctga

DBGET integrated database retrieval system