KEGG   Rhodospirillum photometricum: RSPPHO_01153Help
Entry
RSPPHO_01153      CDS       T01851                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rpm  Rhodospirillum photometricum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSPPHO_01153
Enzymes [BR:rpm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RSPPHO_01153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1432507..1433184)
Genome map
AA seq 225 aa AA seqDB search
MTSIIDRGEPRVVLDPLEGGALSKPSYPTHKPSRQEAEEAVRVLLRWAGDDPNREGLFDT
PARVVRAYEEFFEGYGADPEEILRRTFEEVEGYDEMVLLRDIRLESHCEHHMVPIIGKVH
IAYLPNRRVVGISKLARVAEAYAKRLQIQETMTAQIANAINTVLEPKGVAVVVEAAHQCM
TTRGIRKPGVTMVTSRMLGAFRDNSDTRREFLHLIGQVRDASLGA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcatcatcgaccggggagagccgcgcgtggttctcgatcctcttgagggcgga
gctttgagcaagccgtcgtatcccacccacaagccgtcccgccaggaagccgaagaagcg
gtgcgtgtgctcctgcgctgggccggcgacgatcccaaccgcgagggcctcttcgacacc
ccggcccgcgtcgtgcgcgcctacgaagaattcttcgagggctatggcgccgatcccgaa
gaaatcttgcgccgcaccttcgaggaggtcgagggctacgacgaaatggtcctcctgcgc
gacatccgtttggaaagccactgcgagcaccacatggtgccgatcatcggcaaggttcac
atcgcctacctgcccaaccgtcgggtggtcggtatttccaaactggcccgcgtcgccgag
gcctacgccaagcgcctccagatccaagaaaccatgacggcccagatcgccaacgccatc
aacaccgtcttggagcccaagggcgtcgccgtcgtcgtcgaggccgcccaccagtgcatg
accacccgcggcattcgcaagcccggcgtgaccatggtcaccagccgcatgctcggcgcc
ttccgcgacaactccgatacccggcgcgagttcctccatctgatcgggcaagttcgcgac
gccagccttggggcctag

DBGET integrated database retrieval system