KEGG   Pararhodospirillum photometricum: RSPPHO_01176Help
Entry
RSPPHO_01176      CDS       T01851                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase, putative
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00521  Streptomycin biosynthesis
rpm00523  Polyketide sugar unit biosynthesis
rpm01130  Biosynthesis of antibiotics
Module
rpm_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RSPPHO_01176 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSPPHO_01176 (rfbC)
Enzymes [BR:rpm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RSPPHO_01176 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CCG07802
UniProt: H6SSC3
Position
complement(1452357..1452920)
Genome map
AA seq 187 aa AA seqDB search
MTGRLAVRDLPLPGLKRVERQRLGDHRGFLSRLFCAETLEAAGWRKPLAQINQTLTRERG
TVRGLHYQKPPAAEIKLVMCLKGAIWDVAVDVRRGSSTFLHHHGEILSEENGYALLIPEG
FAHGFQALTADVELLYCHSAPHAPDLEAGLNVADPRLALPWPLPVTGLSVRDAGQALLTP
DFEGVVL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacggggcgtcttgcggtacgggatctccccctgcccggcttgaagcgggtggagcgc
cagcggttgggcgatcaccggggctttttgtcccggttgttctgtgccgaaaccttggaa
gcggccggctggcgcaagccccttgcccagatcaaccagaccctcacccgcgagcgggga
actgtgcgcggcctgcactatcagaagccaccggcggccgagatcaagctggtgatgtgc
ctgaaaggggccatctgggatgtggccgtggacgtgcgccggggctcgtccaccttcttg
caccaccatggagagatcctctcggaagagaacggctatgctctgctgattcccgaaggc
tttgcccatgggttccaggcgctcaccgccgatgtggaactcctgtactgccattccgcc
ccccatgcgcccgatctggaagcgggcctgaacgtggctgatccccgcctagccctgccc
tggccgctgccggtgacgggcctgtcggtgcgggatgcggggcaggccttgctaacccct
gactttgaaggagtggtgctgtga

DBGET integrated database retrieval system