KEGG   Rhodospirillum photometricum: RSPPHO_01314Help
Entry
RSPPHO_01314      CDS       T01851                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
rpm  Rhodospirillum photometricum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rpm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1594820..1595290)
Genome map
AA seq 156 aa AA seqDB search
MRAALEAVAATVRDCPVCGNVDTQTPCGICADSRRDPSVVCVVRDVADLWALERGGAFRG
RYHVLGGLLSALDGIGPDDLGLDRLEARLGPEAVREVILALPATVEGQTTAHVVADRLEP
RGVLVSGLAQGVPVGGELEYLDDGTLSAALAARRPV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgccgccctggaggccgtcgccgccacggtgcgcgactgcccggtgtgcggcaat
gtcgatacgcaaaccccgtgcggcatttgtgccgactctcggcgcgatccgagcgtggtg
tgtgtggtgcgcgacgtggccgacctgtgggccctggagcgcgggggcgcctttcgcggg
cgctaccatgtgttgggcggcttgctgtccgccctggacggcattgggcccgatgacttg
ggccttgaccgtctggaggcccgcctggggcccgaggcggtgcgcgaagtgatcttggca
ttgcctgctacggttgaggggcagacgacggcccatgtcgtcgccgatcgcctggagccc
cggggcgtgctggtctccggcttggcgcagggggtgccggtcgggggggagctggagtat
cttgatgacgggaccttgagcgcggccttggcggcgcggcgtcccgtgtag

DBGET integrated database retrieval system