KEGG   Rhodospirillum photometricum: RSPPHO_01314Help
Entry
RSPPHO_01314      CDS       T01851                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
rpm  Rhodospirillum photometricum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RSPPHO_01314 (recR)
DNA repair and recombination proteins [BR:rpm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RSPPHO_01314 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1594820..1595290)
Genome map
AA seq 156 aa AA seqDB search
MRAALEAVAATVRDCPVCGNVDTQTPCGICADSRRDPSVVCVVRDVADLWALERGGAFRG
RYHVLGGLLSALDGIGPDDLGLDRLEARLGPEAVREVILALPATVEGQTTAHVVADRLEP
RGVLVSGLAQGVPVGGELEYLDDGTLSAALAARRPV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgccgccctggaggccgtcgccgccacggtgcgcgactgcccggtgtgcggcaat
gtcgatacgcaaaccccgtgcggcatttgtgccgactctcggcgcgatccgagcgtggtg
tgtgtggtgcgcgacgtggccgacctgtgggccctggagcgcgggggcgcctttcgcggg
cgctaccatgtgttgggcggcttgctgtccgccctggacggcattgggcccgatgacttg
ggccttgaccgtctggaggcccgcctggggcccgaggcggtgcgcgaagtgatcttggca
ttgcctgctacggttgaggggcagacgacggcccatgtcgtcgccgatcgcctggagccc
cggggcgtgctggtctccggcttggcgcagggggtgccggtcgggggggagctggagtat
cttgatgacgggaccttgagcgcggccttggcggcgcggcgtcccgtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system