KEGG   Pararhodospirillum photometricum: RSPPHO_01357Help
Entry
RSPPHO_01357      CDS       T01851                                 

Definition
(GenBank) Short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00071  Fatty acid degradation
rpm00280  Valine, leucine and isoleucine degradation
rpm00281  Geraniol degradation
rpm00310  Lysine degradation
rpm00360  Phenylalanine metabolism
rpm00362  Benzoate degradation
rpm00380  Tryptophan metabolism
rpm00410  beta-Alanine metabolism
rpm00627  Aminobenzoate degradation
rpm00640  Propanoate metabolism
rpm00650  Butanoate metabolism
rpm00903  Limonene and pinene degradation
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
rpm01120  Microbial metabolism in diverse environments
rpm01130  Biosynthesis of antibiotics
rpm01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RSPPHO_01357
   00650 Butanoate metabolism
    RSPPHO_01357
  Lipid metabolism
   00071 Fatty acid degradation
    RSPPHO_01357
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSPPHO_01357
   00310 Lysine degradation
    RSPPHO_01357
   00360 Phenylalanine metabolism
    RSPPHO_01357
   00380 Tryptophan metabolism
    RSPPHO_01357
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSPPHO_01357
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RSPPHO_01357
   00281 Geraniol degradation
    RSPPHO_01357
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSPPHO_01357
   00627 Aminobenzoate degradation
    RSPPHO_01357
   00930 Caprolactam degradation
    RSPPHO_01357
Enzymes [BR:rpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RSPPHO_01357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: CCG07983
UniProt: H6SJ18
Position
complement(1651793..1652569)
Genome map
AA seq 258 aa AA seqDB search
MAYDTILVETSGKVGVITLNRPKALNALSSGLIRDLGAALDAFEANPDVRVIVLTGSEKA
FAAGADIKEMAGKSYMDAYLEDFITLGWERVTKCRKPVIAAVAGFALGGGCELAMMCDMI
IAADNAKFGQPEINLGTMPGAGGTQRLTRFVGKSKAMDMCLTGRMMDADEAWKCGLVSRI
VPLDDLRDEVMKIAETIADKSLPIAMMVKEAVNTAYETTLAQGIHYERRVFHATFATDDQ
KEGMTAFIEKRQPSFTDR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgacaccatcctcgtggaaaccagcggcaaggtcggggtgatcaccctcaac
cgacccaaggcgctcaacgcgctgtcctcgggtctgatccgggatcttggcgcggcgctg
gatgccttcgaggccaacccggacgttcgcgtcatcgtcctgaccggctcggagaaggcc
ttcgcggccggcgccgacatcaaggagatggccggcaagtcctacatggatgcctatctc
gaggacttcatcaccctgggctgggaacgcgtcaccaagtgtcgcaagccggtgatcgcc
gcagtggccggtttcgccctgggcggcggctgcgagttggccatgatgtgcgacatgatc
atcgccgccgacaacgccaagttcggccagcccgagatcaacctgggcaccatgcccggc
gccggcggcacccagcgcctcacccgctttgtcggcaagtccaaggccatggacatgtgc
ctgaccgggcgcatgatggatgccgacgaggcctggaagtgcggccttgtcagccgcatt
gtgccgcttgatgacctgcgcgacgaggtgatgaagatcgccgagaccatcgccgacaag
agtctgcccattgccatgatggtcaaggaagcggtcaacaccgcctacgaaaccaccctg
gcccagggcatccactacgaacgccgggtgttccacgccaccttcgccaccgacgaccag
aaagaaggcatgaccgccttcatcgaaaagcgccagcccagcttcaccgaccgctaa

DBGET integrated database retrieval system