KEGG   Rhodospirillum photometricum: RSPPHO_01468Help
Entry
RSPPHO_01468      CDS       T01851                                 

Definition
Lipolytic enzyme, G-D-S-L (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rpm  Rhodospirillum photometricum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RSPPHO_01468
Enzymes [BR:rpm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RSPPHO_01468
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RSPPHO_01468
Lipid biosynthesis proteins [BR:rpm01004]
 Fatty acid synthase
  Component type
   RSPPHO_01468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1769222..1769914
Genome map
AA seq 230 aa AA seqDB search
MPVLSWLRPPRRQGSSRYGAAGRVINVGVLLLALAIGSARATETAPVVVAVLGDSLVAGY
NIAAEEAFPARLEAALRARGHQVRVLNAGVSGDTTAGGLARLDWTLSDRPDAVIVELGAN
DGLRGLDPERTRANLDTLVTRLKGAGKKVLLAGMQAPPNMGRDYAEAFNAIYPALAAKHQ
VLFDPFFLEGVAGVPALNLSDGIHPNPAGVDVMVARLLPLAEKLVEGQQP
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcctttcctggttgcgcccgccccgacggcaggggtcctcccgatatggggcg
gccgggcgcgtcatcaatgtgggggtcttgctgctggccctggccatcggctcggcccgg
gccaccgaaaccgccccggtggtggtcgccgtgctcggcgacagcttggttgccggctac
aacatcgccgccgaggaggcctttcccgcccgtttggaagccgccttgcgggcccggggc
catcaggtgcgggtgctcaatgccggcgtatccggcgataccacagcgggcggcttggcc
cggctcgactggacactcagcgaccgtcccgatgccgtgattgtggaactgggcgccaac
gatggcctgcgcggccttgatcccgagcgcacccgcgccaacctggacaccctggtcacc
cgtctcaagggcgccggcaagaaagtgctgctggccggcatgcaggcgccgcccaacatg
ggccgcgactatgccgaggccttcaacgccatttatcccgccctggccgccaagcatcag
gtgttgttcgatccgttttttctggagggcgtggccggggtgcccgcccttaacctgagc
gacggtatccatcctaatccggccggtgtggacgtcatggtcgcgcgcctgctgcccctg
gccgaaaagttggtggaaggacagcagccgtga

DBGET integrated database retrieval system