KEGG   Rhodospirillum photometricum: RSPPHO_01487Help
Entry
RSPPHO_01487      CDS       T01851                                 

Definition
Protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rpm  Rhodospirillum photometricum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RSPPHO_01487
Enzymes [BR:rpm01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RSPPHO_01487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1789393..1790562
Genome map
AA seq 389 aa AA seqDB search
MPRGGGGGHTPGSFSRDNLGRGATMLMDKDSTPSAEGSAKAGAARRKRGAVFPFSAIVGQ
EEMTLALLIAAVDPAIGGVMVFGDRGTGKSTAVRGLAQLLPPMPVVKGCPYGCDPAGDLT
RCPAGCSSHKAEGTLEVDAVPVPVVDLPLGATEDRVVGALDLERALTRGEKAFEPGLLAS
ANRGFLYIDEVNLLEDHLVDLLLDVAASGENVVEREGLSIRHPARFVLIGSGNPEEGELR
PQLLDRFGLSVEVRTPTDLKVRVEVVRRRDTFERDPAAYVAQWAEADAAVRERLLAAKAR
LPHVEVPDALLEQAARLCMALGTDGLRGELTLMRAARAVAALEGDTVLTLDHLRRVAPPA
LRHRLRRDPLDESGSTTRVLRAMEEVLGS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ttgcctcgtggcggggggggcgggcatactcccggctctttttcccgggataatttaggt
cgaggcgccacaatgctcatggacaaggacagcacaccgtcggccgagggctccgcaaag
gccggagccgcacgacgcaagcgcggtgccgtctttccgttttccgccatcgtcggtcag
gaggagatgaccctggccctgttgatcgccgccgtggatcccgccatcggcggtgtcatg
gtgtttggcgatcgcggcaccggcaaatcgaccgccgtgcgcggtctggcccagttgctg
ccgcccatgcccgtcgtcaagggctgtccctacggctgcgatccggcgggcgatctcacc
cgctgccccgccggttgctccagccacaaggccgagggcaccttggaggtggacgccgtg
cccgtgcccgtcgtggatctgccgcttggcgccaccgaggaccgcgtcgttggggccctt
gatctcgagcgcgccctcacgcgtggcgaaaaggccttcgagcccggcctgctggccagc
gccaaccgcggcttcctttatatcgacgaagtgaacctgctcgaagaccatctggtggac
ctgctgcttgacgtggccgcctcgggcgaaaacgtggtcgagcgcgagggcctgtccatc
cgccacccggcccgcttcgtgctcatcggctcgggcaacccggaagagggcgaactgcgg
ccccagctccttgaccgctttggtctctcggttgaggtgcgcacgccgaccgatctcaag
gttcgcgtcgaggtcgtgcgccgtcgcgacaccttcgagcgcgatcccgccgcctacgtc
gcccagtgggccgaggccgatgccgccgtgcgtgagcgcctgctggccgccaaggcccgc
ctgccccacgtcgaggtgcccgatgccctgctggagcaggccgctcgcctgtgcatggcg
cttggcaccgatggcctgcgcggcgaattgaccctgatgcgcgccgcccgcgcggttgcc
gccttggagggggacaccgtcttgaccctcgatcacctgcgccgggtggcaccgccggcc
ctgcgccatcgtctgcgccgcgacccgcttgacgaatccggctccaccacccgcgttctg
cgcgccatggaggaagtgctggggtcatga

DBGET integrated database retrieval system