KEGG   Rhodospirillum photometricum: RSPPHO_02033Help
Entry
RSPPHO_02033      CDS       T01851                                 

Definition
(RefSeq) Enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpm  Rhodospirillum photometricum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RSPPHO_02033
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RSPPHO_02033
   00650 Butanoate metabolism
    RSPPHO_02033
  Lipid metabolism
   00071 Fatty acid degradation
    RSPPHO_02033
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSPPHO_02033
   00310 Lysine degradation
    RSPPHO_02033
   00360 Phenylalanine metabolism
    RSPPHO_02033
   00380 Tryptophan metabolism
    RSPPHO_02033
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSPPHO_02033
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RSPPHO_02033
   00281 Geraniol degradation
    RSPPHO_02033
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSPPHO_02033
   00627 Aminobenzoate degradation
    RSPPHO_02033
   00930 Caprolactam degradation
    RSPPHO_02033
Enzymes [BR:rpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RSPPHO_02033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2422745..2423761
Genome map
AA seq 338 aa AA seqDB search
MTYDEILFTVEKGVARVTLNRPKAHNALTLSKIRHLDPALRVWADDPDVRLVVIEGTGER
AFCAGGDVRAMAEAVHDGRFADNEAFFAEEYRLNRLIKTYEKPFIALMDGITMGGGVGIS
VHGRFRVVTERTVFAMPETGIGMFPDVGGTFFLPRLPGRVGTWLALTGARLKAPDLLALG
LATHHIPAERLDELKQALMSSPHPAQVLNHYHVDPGPGVLTNEQRVLIDRCFASDSVEAI
VAVLEAQNDPWAQDACETILAKSPTASKITLHQMRLGATLTFDAAMDLEYRIATRITRLP
DFYEGVRAVLIDKDNTPRWSPASLEAVASQTVEAVFAP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgatgaaatcctgtttacggttgaaaagggtgttgcccgcgtcaccctcaac
cggccgaaggcgcacaatgccctgacgctgtccaagatccgccatctcgatccggccttg
cgcgtgtgggccgatgatcccgatgtgcgccttgtggtcatcgagggcacgggggagcgg
gcgttctgcgccgggggcgacgtgcgcgccatggccgaggcggtccacgatgggcgcttc
gccgacaacgaggccttttttgccgaggaataccgcctcaaccgcctgatcaagacctac
gagaagccgttcatcgccctgatggacggcatcaccatggggggcggcgttggcatctcg
gtgcacggccgcttccgggtggtgaccgagcgcaccgttttcgccatgcccgagaccggc
attggcatgttccccgacgtgggcggaaccttctttttgccccgcctgccgggccgggtc
gggacgtggctcgctctgaccggggcccggctcaaggcccccgacctgctggcgctgggc
cttgccacccaccacatccccgccgagcgcttggacgaactcaagcaggcgctcatgagc
agcccccatcccgcccaggtgctgaaccattaccacgtcgatcccggcccgggcgtcctg
accaacgagcagcgcgtgttgatcgaccgctgtttcgcctccgacagtgtcgaggccatc
gttgcggttctggaggcccaaaacgacccctgggcccaggacgcttgcgagacgatcctc
gccaaatcgcccaccgcctccaagatcacgctgcaccagatgcgcctgggcgccaccttg
accttcgatgcggccatggacctggaataccgcatcgccacgcgcatcacccggttgccc
gacttttacgaaggcgtgcgcgctgtgttgattgacaaggataataccccgcgctggtcg
cccgcctccttggaggccgtggcgtcccagacggtcgaggctgttttcgccccctga

DBGET integrated database retrieval system