KEGG   Rhodospirillum photometricum: RSPPHO_02217Help
Entry
RSPPHO_02217      CDS       T01851                                 

Definition
hypothetical protein
Orthology
K00832  
aromatic-amino-acid transaminase [EC:2.6.1.57]
Organism
rpm  Rhodospirillum photometricum
Pathway
Cysteine and methionine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tyrosine biosynthesis, prephanate => pretyrosine => tyrosine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpm01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:rpm00270]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rpm00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:rpm00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rpm00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:rpm00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2654647..2655855)
Genome map
AA seq 402 aa AA seqDB search
MDGTMFEHVDAYAGDPILSLMERFKADPRPEKVNLSIGLYYDEDGKVPLLRALAEAKARL
DARPPEAKLYLPMEGLASYRDAIQALLFGEDSAVRAERRVATLQTLGGSGALKVGADFLH
RYFPQSEVWVSAPTWDNHVAIFEGAGFRTHTYPYFDPTTRGVDFTGMLACLATLPPQAIV
LLHPCCHNPTGSDLTNAQWDQVVEVVRERRLIAFLDIAYQGFAEGMEEDAYALRALAAAG
LTFLVSNSFSKIFSLYGERVGGLSVVCDTEETAQRVLGQLKAAVRRNYSSPPTRGATLVE
IVLHDPDLKATWIAEVAAMRARIVAMRESLVVALKEALPAVNVDHLVQQRGMFSYTGLSP
EQVDRLRDEFAIYLVRSGRICVAGLNLGNVDRVAQAFARVVA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtggacggaacgatgttcgagcatgtcgatgcgtatgcgggagatcccattctctcgctc
atggaacggttcaaggctgaccctcggccggaaaaggtcaatctgagcatcggcctttat
tatgacgaagacggcaaggtgcccttgctgcgggccctggccgaggccaaagcccgtctc
gacgcccggccacccgaggccaagttgtatttgcccatggaaggcttggcctcctaccgc
gatgccatccaggcccttttgttcggcgaagacagcgctgtccgggccgagcgccgcgtc
gccaccctccaaacgctgggcggctccggcgccctcaaggtgggcgccgacttcttgcat
cgctatttcccccagtccgaagtgtgggtcagtgcgccaacctgggacaatcacgtcgcg
attttcgagggcgccggctttcgtacccacacctatccctatttcgatcccacgacccgg
ggcgttgatttcacaggcatgttggcctgcctcgccaccttgcccccccaggccatcgtg
ttgttgcatccctgttgccacaacccgaccggttccgacctcaccaacgcccagtgggac
caagtggtcgaggtcgtgcgtgagcgccggctcattgccttcctcgacatcgcctatcaa
ggctttgccgaaggcatggaggaggatgcctacgccctgcgtgccctggcggcggccggc
ttgaccttcctggtttccaactcgttttccaagatcttctccctctatggggagcgcgtc
ggcgggctgtccgtggtgtgcgatacggaggaaacggcccagcgcgtgctcggccagctc
aaggccgccgtgcggcgcaactattccagcccgccgacccggggcgcgaccctggtcgag
atcgtcttgcacgaccccgacctcaaggccacctggatcgccgaggtcgcagccatgcgc
gcgcgcatcgtggccatgcgggagagccttgttgtcgcgttgaaggaagccctgccggcg
gtcaatgtcgatcacttggtccagcagcgcggcatgttcagctacaccggtctgagtccc
gagcaggtggatcgcctgcgcgacgagttcgccatttatctggtgcgcagtggccggatt
tgtgtggctggccttaacctggggaatgttgatcgggtggcgcaggcttttgcgcgtgtg
gtggcctga

DBGET integrated database retrieval system