KEGG   Rhodospirillum photometricum: RSPPHO_02411Help
Entry
RSPPHO_02411      CDS       T01851                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rpm  Rhodospirillum photometricum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rpm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rpm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rpm00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rpm00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rpm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2879146..2880375
Genome map
AA seq 409 aa AA seqDB search
MRIGSMFKGKVLVAQGGGPTAVINQSMVGAVLESRKFRNVELVYGAAHGVRGIVDEEFLD
LTQETTHNLEMVAETPSSALGSTRDKPDLKYCQEIFKVLKAHEIGYFFYIGGNDSSDTVR
IVSDEAKNAGYDLRCVHIPKTIDNDLMVNDHTPGFPSAARFVAQAFMGINLDNWALPGVY
IGVVMGRHAGFLTAASALGKKFPDDGPHLIYLPERTFDPEQFVADVKRVYDTYGRCVVAV
SEGIHDATGAPIITRLTDQVERDAHGNVQLSGTGALADLLVDLVKKKTGIKRVRGDTLGY
LQRSFVGCVSDVDQREAREVGEKAVQFAMWGSRDGSVTIHRTGFYSVDYHFTELTEVAGK
TRVMPDNFIAASGNDVTDAFLMYLRPLLGRGLPDAYRLRNNYVPKVLNP
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaggataggcagcatgttcaagggtaaggttcttgtcgcccagggcggcggacccacg
gccgtcatcaaccagtccatggtcggcgcggttttggaatcgcgcaagttccgcaatgtc
gagttggtgtacggcgccgcccatggcgtgcgcggcatcgtcgatgaggaattcctcgac
ctgacccaggagacgactcacaacctggagatggtggccgagaccccctcgtccgcgctg
ggctcaacgcgcgacaagccggatttgaaatattgccaggagatcttcaaggtcctgaag
gcccatgagatcggctatttcttttacatcggcggcaacgactcctcggataccgtacgc
attgtgtcggacgaggcgaagaacgccgggtatgacctgcgctgcgtccacatccccaag
accatcgacaacgacctgatggtcaacgaccacaccccgggctttccctcggcggcgcgc
ttcgtggcccaggccttcatgggcatcaacctcgacaactgggccctacctggggtgtac
attggcgttgtcatgggccgccatgccggctttttgaccgccgccagcgcgctgggcaag
aagttccccgacgacggcccccacctgatctacctgcccgagcggacctttgatcccgag
cagtttgtcgccgacgtcaagcgggtttacgacacctacggccgttgcgtggtcgcggtg
tccgaaggcatccacgatgcgaccggcgcgccgatcatcacccgcctgaccgatcaggtc
gagcgcgatgctcacggcaacgtccagctctccggcaccggcgccctggccgacctgctg
gttgatctcgtcaagaaaaagaccgggatcaagcgggtgcgcggcgataccctgggctac
ctccagcgctccttcgtcggctgcgtctccgacgtggaccaacgcgaggcccgcgaggtc
ggggaaaaggcggtgcagttcgccatgtggggctcgcgcgatgggtcggtcaccatccat
cgcaccggtttctactcggtcgattatcatttcaccgaactgaccgaggtcgccggcaag
acccgcgttatgcccgacaacttcatcgccgccagcggcaacgacgtgaccgacgccttc
ttgatgtatctgcgtccgttgctgggccggggcctgcccgacgcctatcgcctgcgcaac
aactacgtcccgaaggttctgaacccctaa

DBGET integrated database retrieval system