KEGG   Rhodospirillum photometricum: RSPPHO_02455Help
Entry
RSPPHO_02455      CDS       T01851                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rpm  Rhodospirillum photometricum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rpm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rpm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2944806..2945780)
Genome map
AA seq 324 aa AA seqDB search
MSAPTIPDYRHRHLLGIEGLLPHEITALLDHADRYVGNTRLPDRSQSVLYGGTVINLFFE
NSTRTRTSFEVAAKRLGADVINMQVASSSVSKGETLIDTAVTLNAMHPDILVIRHPESGA
AALLAQKVNCAVINAGDGSHEHPTQALLDALTIRRRKGHLSGLEVAICGDVQHSRVARSN
IHLLTTMGANVRVVGPRPLVPSGMRQLGVSVHYDLREGLRDADIIMMLRLQNERMSGNVL
PSVREYFRFFGLDRDKLALAKPDALIMHPGPMNRGVEIDSDVADDFARSVIREQVEMGVV
VRMAVLDVLCAQLRRSEGGAHGPA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaccaacgattcccgactatcgccaccgccatcttttgggcatcgaggggctg
ttgccccacgagatcacggccctgcttgaccacgccgatcgctacgtaggcaatacccgc
ttgcctgatcgcagccaaagcgtgttgtatggcggtaccgtcatcaaccttttttttgaa
aactcgacacgcacgcgcacgagtttcgaggtcgcggccaagcgcctgggcgcggatgtg
atcaatatgcaagtggcctcctccagcgtctccaagggggaaaccctgatcgacacggcg
gtcacgctgaacgccatgcacccggacatcttggtgatccggcacccggaatccggcgcg
gcggccttgctggcgcaaaaggtcaattgcgcggtgatcaacgcgggcgacggcagtcac
gagcatcccacccaggctctcctcgatgccctgaccattcggcggcgcaagggacatttg
agcggtctggaagtggcgatctgcggcgatgtccaacattcccgggtcgcccgctcgaac
atccacctgctgaccaccatgggagccaacgtgcgggttgttggtccgcgccccctggtg
ccctctggcatgcgccagttgggggtgagtgtccattacgatttgcgcgaaggcctgcgc
gacgccgacatcatcatgatgttgcgactgcaaaatgaacgcatgtcgggcaatgttttg
cccagcgtgcgcgagtatttccgctttttcggccttgaccgcgacaagctggccctggcc
aagcccgatgccctcatcatgcatccgggcccgatgaatcgcggggtcgagattgactcc
gatgttgccgacgacttcgcgcgaagcgtaatccgcgaacaggtcgagatgggagtggtg
gtccgcatggcggtcctggatgttctgtgcgcccagttgcgccgttccgagggaggggcg
catggcccagcgtga

DBGET integrated database retrieval system