KEGG   Rhodospirillum photometricum: RSPPHO_02512Help
Entry
RSPPHO_02512      CDS       T01851                                 

Definition
Succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpm  Rhodospirillum photometricum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSPPHO_02512
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSPPHO_02512
   00650 Butanoate metabolism
    RSPPHO_02512
  Energy metabolism
   00190 Oxidative phosphorylation
    RSPPHO_02512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3019824..3020252)
Genome map
AA seq 142 aa AA seqDB search
MDRRPRRRLTRENVMSLRSSLGRARGLGAAKEGAASHWMAERLPAIALVPLVLWFVFVAI
IPNLGASHAEVVAFMGSPINAALMLLTVLCAFYHGMLGLIVILEDYVQNHTARNVVVFAT
KLYAALGAALATVSILKLSVGG
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgccggcctcgccgccgtctgacaagggagaacgtgatgtctcttcgttcgtct
ctgggccgcgcccggggtcttggtgccgccaaggaaggcgccgcctcgcactggatggcc
gagcgcctgcccgccatcgccctggtgccgttggtgctgtggtttgtgtttgtggcgatc
attcccaacctgggcgcgtctcacgccgaggtggtggctttcatgggctcgcccatcaac
gccgccttgatgctgctgaccgtcctttgtgccttctaccatggcatgctggggctgatc
gtgattctggaggactacgtccagaaccatacggcgcgtaatgtcgtggtgttcgcgacc
aagctgtatgccgccttgggggccgcgctggccaccgtttccatcctcaagctcagcgtc
ggaggctga

DBGET integrated database retrieval system