KEGG   Rhodospirillum photometricum: RSPPHO_02666Help
Entry
RSPPHO_02666      CDS       T01851                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rpm  Rhodospirillum photometricum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RSPPHO_02666
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RSPPHO_02666
Enzymes [BR:rpm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     RSPPHO_02666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3195453..3196955)
Genome map
AA seq 500 aa AA seqDB search
MMTPRRTSILRLADAFTVLGLPVPAGLDPTLTLTGLTADSRAVAPGMLFAALVGQKGDGR
SYIPQALAAGACAVLALPDTQVPKGTVLIGVGEPRRALALLAAAFYGPTPQPLVAVTGTN
GKTSTVTFAAALWRHLGQAGAASLGTLGVHGAGFDRPGSLTTPDPVVLHRILAELAQAGA
GPVAMEASSHGLEQDRLAGVRLAAGAITNITRDHLDHHGTMEAYRAAKFRLFIDVLPEGA
AAVINADIPEAGTLVAMARARSLRLLRYGRIGEELRLVSTTPLPHGQRVTLDILGERIEV
ELPLAGLFQVYNALAALGLVLGAASKAEASYLERAVEGLAHLPGVPGRLEKVAQRRNGAT
VYVDYAHTPDALETVLQALRPHCAERLVCVFGCGGDRDPGKRPLMGALAAQLADAVVVTD
DNPRSEDPASIRAQILAACPQAQEIGDRGRAICESVARLAAGDVLVIAGKGHETGQTIGS
VTHPFNDAEHARDAVRKEDA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacgccacggaggacaagcatcttgcggctcgctgatgccttcacggtcctgggc
ctgccggtgccggcgggtcttgacccgaccctcaccctgacgggcctgaccgcggactcg
cgggcggtcgcgccgggcatgctttttgcggcactggtcggtcagaagggggacggtcgc
agttatatcccgcaagcactggcggccggggcctgcgcggtgctggccctgcccgacacc
caggtgcccaagggtacggtcttgatcggcgttggcgaaccgcgccgggccctggccttg
ctggcggccgcgttttatggccccacgccccagcccctggtcgcggtgaccgggaccaac
ggcaagacctcgacggtcacctttgccgcggccttgtggcgtcatctggggcaggccggc
gccgccagtctgggcaccttgggagtgcacggggcgggctttgaccgaccggggtcgctc
accacccccgacccggtggtgctgcatcggatcttggccgagttggctcaggccggcgcc
gggccggtggcgatggaggcctcgtcgcatggcctggagcaagaccggctggccggcgtg
cggctggcggccggagccatcaccaacatcacccgcgaccacctggaccaccacggcacc
atggaagcgtaccgggcggcgaaattccggctgttcatcgacgtgctgcccgagggggcg
gcagcggtgatcaatgccgacattcccgaggcgggcaccttagttgccatggcccgcgcc
cgctccttgcgcctgctgcgctatggccggattggcgaggagcttcggttggtctcgacc
acgcctttgccccatggccaacgggtgacgcttgacattttgggggaacgaatcgaggtc
gagctgcccctggccggcctgttccaggtctataatgcgctggcggccctgggcttggtc
ctcggcgccgcgtcgaaggcagaggcctcttatctcgagagagccgtggagggtctggcc
cacctgcctggcgtgccggggcgtctggaaaaggtggcccagcggcgcaacggcgccacg
gtgtatgtggactatgcccacacccccgatgccctggaaaccgttcttcaggccttgcgc
ccccattgcgccgagcggctggtctgcgtgtttggctgcggcggggaccgggacccgggc
aaacgtcccttgatgggagccctggcggcccagttggccgacgcggtggtggtcaccgac
gacaacccgcgctccgaggatccggcgtccattcgcgcccagatcctggccgcctgcccg
caggcccaggagatcggcgaccggggccgggcgatctgcgagagtgtggcgcggcttgcg
gcgggcgacgtgctggtgatcgccggcaagggacacgagaccggccagaccatcgggagc
gtcacccatccgttcaacgacgccgagcacgcccgggacgcggtgcgaaaggaggacgca
tga

DBGET integrated database retrieval system