KEGG   Rhodospirillum photometricum: RSPPHO_02671Help
Entry
RSPPHO_02671      CDS       T01851                                 

Definition
Tryptophan synthase, beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpm  Rhodospirillum photometricum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rpm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rpm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3201291..3202745
Genome map
AA seq 484 aa AA seqDB search
MFLGSAAYARGNRPESLFAANRDGEALFRLFWAKWLKKCKRRRFIWPSSEGSLLFPRFGG
CAITTAPVRTQGKAMTQTLNTFRSGPDERGRFGPFGGRYVAETLMPLILDLEKAWDSAKN
DPAFQAELDGYLKSYVGRPSPLTLAQRLTEALGGARIYFKREDLNHTGAHKVNNCMGQIL
LARRMGKTRIIAETGAGQHGVATATVCALFGLQCVVYMGATDMARQAPNVFRMKLLGAEV
RPVTSGSGTLKDAMNEALRDWVTNVASTYYLIGTAAGPHPYPAMVRDLQKIIGEETRAQI
QAVEGRLPDTVVACVGGGSNAIGMFHPFLDDPSVRLIGVEAAGEGLDKRHACSMAGGRPG
VLHGNRTYLLQDADGQITEAHSLSAGLDYPGVGPEHAWLKDVGRVEYVPITDDEAVDAFQ
RVTRLEGIIPALESSHAVAHVLKIAPALPRDHLVVVSMSGRGDKDIATVAKAMGAEALLK
EIAS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctcggctctgcggcatacgctcgcggaaatcgcccggaatccttgtttgcggcg
aatcgcgatggagaagctctatttaggctcttctgggcgaaatggttaaaaaagtgcaaa
cggcgccgttttatttggccatcctcggaagggagcctcctctttccccggttcgggggg
tgcgctataaccaccgccccggtgcgcactcaaggaaaagccatgactcagaccctcaat
accttccgcagcggccccgatgaacgggggcggttcggcccgttcggcggccggtatgtg
gccgagactctcatgcccctcatccttgatctggaaaaggcctgggactcggcaaaaaac
gatccggcgttccaggccgagctggatgggtatctcaagagctacgtgggacgcccgagc
ccgctcaccctggcccaacgcctgaccgaggccctgggcggagctcggatctatttcaag
cgcgaagacctcaatcacaccggcgcccataaggtgaacaactgcatgggccagatcctt
ctggcccggcgcatgggcaagacccgcatcatcgccgagaccggtgccggccagcacggc
gtggccaccgccaccgtgtgcgccctgttcggccttcagtgcgtcgtctacatgggcgcc
accgatatggcccgccaagcgcccaatgtttttcgcatgaagctcttgggcgccgaggtg
cggccggtgaccagcggctcgggcaccctcaaggatgccatgaacgaggccctgcgcgac
tgggtgaccaacgtcgcgtccacctattacctgatcggcaccgccgccgggccccatccc
tatcccgccatggtgcgtgacttgcaaaagatcatcggcgaggaaacccgcgcccagatc
caggccgtggaagggcggctgcccgataccgtggtcgcctgcgtcggcggcggctccaac
gccattggcatgttccatcccttcctcgacgatcccagcgtgcgcctgatcggggtcgag
gcggccggcgaaggtctggataagcgccatgcctgctccatggccgggggacggccgggc
gtgctgcacggcaaccgcacctatctgctgcaagatgccgatggccagatcaccgaggcc
cattcgctctccgctggcctcgactatcccggcgttggccccgaacatgcgtggctcaag
gatgtgggccgcgtcgaatacgtgcccatcaccgacgacgaggccgtggacgccttccag
cgcgtcacccgtctggagggcatcatccccgccctcgagagcagccacgccgtcgcccac
gtcctcaagatcgcccccgccttgccacgcgaccacctcgtggtcgtcagcatgagcggg
cggggcgacaaggacatcgccacggtggccaaggccatgggcgctgaagccctgctcaag
gagatcgcgtcgtga

DBGET integrated database retrieval system