KEGG   Rhodospirillum photometricum: RSPPHO_02671Help
Entry
RSPPHO_02671      CDS       T01851                                 

Definition
Tryptophan synthase, beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpm  Rhodospirillum photometricum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSPPHO_02671
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSPPHO_02671
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSPPHO_02671
Enzymes [BR:rpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSPPHO_02671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3201291..3202745
Genome map
AA seq 484 aa AA seqDB search
MFLGSAAYARGNRPESLFAANRDGEALFRLFWAKWLKKCKRRRFIWPSSEGSLLFPRFGG
CAITTAPVRTQGKAMTQTLNTFRSGPDERGRFGPFGGRYVAETLMPLILDLEKAWDSAKN
DPAFQAELDGYLKSYVGRPSPLTLAQRLTEALGGARIYFKREDLNHTGAHKVNNCMGQIL
LARRMGKTRIIAETGAGQHGVATATVCALFGLQCVVYMGATDMARQAPNVFRMKLLGAEV
RPVTSGSGTLKDAMNEALRDWVTNVASTYYLIGTAAGPHPYPAMVRDLQKIIGEETRAQI
QAVEGRLPDTVVACVGGGSNAIGMFHPFLDDPSVRLIGVEAAGEGLDKRHACSMAGGRPG
VLHGNRTYLLQDADGQITEAHSLSAGLDYPGVGPEHAWLKDVGRVEYVPITDDEAVDAFQ
RVTRLEGIIPALESSHAVAHVLKIAPALPRDHLVVVSMSGRGDKDIATVAKAMGAEALLK
EIAS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctcggctctgcggcatacgctcgcggaaatcgcccggaatccttgtttgcggcg
aatcgcgatggagaagctctatttaggctcttctgggcgaaatggttaaaaaagtgcaaa
cggcgccgttttatttggccatcctcggaagggagcctcctctttccccggttcgggggg
tgcgctataaccaccgccccggtgcgcactcaaggaaaagccatgactcagaccctcaat
accttccgcagcggccccgatgaacgggggcggttcggcccgttcggcggccggtatgtg
gccgagactctcatgcccctcatccttgatctggaaaaggcctgggactcggcaaaaaac
gatccggcgttccaggccgagctggatgggtatctcaagagctacgtgggacgcccgagc
ccgctcaccctggcccaacgcctgaccgaggccctgggcggagctcggatctatttcaag
cgcgaagacctcaatcacaccggcgcccataaggtgaacaactgcatgggccagatcctt
ctggcccggcgcatgggcaagacccgcatcatcgccgagaccggtgccggccagcacggc
gtggccaccgccaccgtgtgcgccctgttcggccttcagtgcgtcgtctacatgggcgcc
accgatatggcccgccaagcgcccaatgtttttcgcatgaagctcttgggcgccgaggtg
cggccggtgaccagcggctcgggcaccctcaaggatgccatgaacgaggccctgcgcgac
tgggtgaccaacgtcgcgtccacctattacctgatcggcaccgccgccgggccccatccc
tatcccgccatggtgcgtgacttgcaaaagatcatcggcgaggaaacccgcgcccagatc
caggccgtggaagggcggctgcccgataccgtggtcgcctgcgtcggcggcggctccaac
gccattggcatgttccatcccttcctcgacgatcccagcgtgcgcctgatcggggtcgag
gcggccggcgaaggtctggataagcgccatgcctgctccatggccgggggacggccgggc
gtgctgcacggcaaccgcacctatctgctgcaagatgccgatggccagatcaccgaggcc
cattcgctctccgctggcctcgactatcccggcgttggccccgaacatgcgtggctcaag
gatgtgggccgcgtcgaatacgtgcccatcaccgacgacgaggccgtggacgccttccag
cgcgtcacccgtctggagggcatcatccccgccctcgagagcagccacgccgtcgcccac
gtcctcaagatcgcccccgccttgccacgcgaccacctcgtggtcgtcagcatgagcggg
cggggcgacaaggacatcgccacggtggccaaggccatgggcgctgaagccctgctcaag
gagatcgcgtcgtga

DBGET integrated database retrieval system