KEGG   Rhodospirillum photometricum: RSPPHO_02789Help
Entry
RSPPHO_02789      CDS       T01851                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rpm  Rhodospirillum photometricum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSPPHO_02789
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPPHO_02789
   00052 Galactose metabolism
    RSPPHO_02789
   00500 Starch and sucrose metabolism
    RSPPHO_02789
   00520 Amino sugar and nucleotide sugar metabolism
    RSPPHO_02789
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSPPHO_02789
   00524 Butirosin and neomycin biosynthesis
    RSPPHO_02789
Enzymes [BR:rpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RSPPHO_02789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3341988..3343181
Genome map
AA seq 397 aa AA seqDB search
MSSLGPIPDLDSKVGKVARFARPGQRSLSGEGGRDIRRGTREVRGGPLPRPAPVLASPKG
WTPQRLGRTVMTGLIADIGATNARFALTANGGWRDERIFPCDDFPDFVAAARAYLDATLT
PSEPRPTRAAACLPGPVEGDQVSVTNRPTWSFSRGETAAALGLEAFTVVNDFVANALAVP
HLPAASLVRLDETQAPYTPGAPVAVLGPGTGLGVAVLLPGGREALATEGGHVTLAATTRR
EAQVIAALAEAFGHVSAERAVSGPGLVNLAAAVRRLAGLPAVRRLAGLPAVPNEQPADVM
TDGINGRCPVRAEAVSLFFAFLGTVAGNLVLSTGAWGGVWLMGGILPRCVEPLKASPFVR
RLAGKGRFQDRLEAVPRVLVAHPYPAFVGLAGLVDQP
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccctaggcccaatcccggatctggactcgaaggtcggcaaggtagcccggttt
gcgcgccccgggcaacggtccctttcgggggaaggagggcgtgacatcaggcgaggaaca
agagaggtccgaggaggcccacttccccggccggctcctgtgttggcctcgccaaaaggg
tggaccccgcagcgcttaggaaggaccgtcatgaccggactcatcgccgatatcggcgcc
accaatgcccgcttcgccctcacggccaacggcggctggcgcgacgagcggatcttcccc
tgtgacgacttccccgattttgtcgccgctgcccgcgcctacctcgacgccacgctgacg
ccttccgagccccggccaacccgagccgccgcctgcctgcccggtccggttgagggggat
caggtgtcggtgaccaatcgccccacatggtcgttctcccggggcgagaccgccgccgcc
ctggggctggaagcgttcactgtggtcaacgactttgtggccaatgccctggccgtgccc
cacctgccggcggcgtcgctggtgcggcttgacgagacccaggccccttacacgccgggt
gcgccggtggcggtgctgggcccgggaactggcctcggggtggcggttttgctgcccggg
gggcgcgaggccctggcgaccgagggcgggcatgtcaccttggccgccaccacccggcgc
gaggcccaggtgattgccgccctggccgaggcctttggccatgtctcggccgagcgggcg
gtgtcggggccgggtcttgtcaatctagccgccgccgtgcgccgccttgcgggcctgccc
gccgtgcgccgccttgcgggcctgcccgccgtgcccaacgagcagccggccgacgtgatg
accgacgggatcaacggccgctgtccggtgcgggccgaggcggtgtcgctgttttttgcc
tttctgggcacggtggcgggcaatctggtgctctcgaccggggcctgggggggggtgtgg
ctgatgggggggattttgccgcgctgcgtcgaacccctcaaggcctcgccgtttgtccgg
cgtcttgccggcaagggccgctttcaagaccgtctggaggcggtgccccgggtgttggtg
gcccatccctatcctgccttcgtcggccttgccgggcttgttgaccagccatga

DBGET integrated database retrieval system