KEGG   Pararhodospirillum photometricum: RSPPHO_02912Help
Entry
RSPPHO_02912      CDS       T01851                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpm  Pararhodospirillum photometricum
Brite
Enzymes [BR:rpm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RSPPHO_02912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 RrnaAD Methyltransf_25 Methyltransf_18 Methyltransf_9 Methyltransf_32 Methyltransf_23 Methyltransf_12 MTS Methyltransf_11 Methyltransf_24 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: CCG09538
UniProt: H6SPL3
Position
complement(3500025..3500675)
Genome map
AA seq 216 aa AA seqDB search
MDTNTARVNMIKNQIQTSRVSDPLVLEALEAVPRELFVPKARRAVAYVDEDIPVGGGRSL
LEPLILARMLQVAAVAPTDVVLDVGCATGYSSAVLSHMASTVVALESDPDLATKAEATLS
ELGRDNAVVITGPLAEGCPRQAPFNLIFINGAVPAVPVALRDQLADKGRLVAVIRQGAVG
RLTVVERHGAAFSQRVLFDADAPLLKGFAPAPAFIF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaatacggcccgcgtgaacatgatcaaaaaccagatccagaccagccgggtc
agtgatcccctggtgctggaagccctggaggccgtgccgcgcgaactattcgtgcccaag
gcgcgccgggccgtggcctatgtggacgaggatatcccggtgggcggcgggcgctccttg
ctggagccgctgattttggcgcgcatgctccaggtggcggcggtggctcccaccgatgtg
gtgctggatgtgggctgcgccaccggctactcctcggcggtgctgtcccatatggcaagc
acggtggtcgccctggaatccgaccccgacttagccaccaaggccgaagcgaccctgagc
gagttgggccgtgacaacgcggtggtcatcaccggccctctggccgagggctgcccgcgt
caggccccgttcaacctgattttcatcaacggcgcggtgccggctgtcccggtagccctg
cgggaccaactggccgacaagggccggctggtggccgtcatccgccagggcgcggtggga
cgcctgactgtggtcgagcggcatggcgccgcgttcagccagcgcgttctcttcgacgcc
gacgcccccttgctcaagggatttgccccggcgcccgcgttcattttctga

DBGET integrated database retrieval system